KEGG   Thioalkalivibrio nitratireducens: TVNIR_1205Help
Entry
TVNIR_1205        CDS       T02408                                 

Gene name
asnO_[H]
Definition
Asparagine synthetase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tni00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1151792..1153579
Genome map
AA seq 595 aa AA seqDB search
MCGIAGEFVWGDRRADVDAVARMLPALARRGPDADGVWAAGRVALGHRRLSILDLSQRAH
QPMFDPATGLALVFNGAIYNFRTLRAELERRGHRFFSTGDTETILRGYAEWGEAVVGRLH
GMFAFALFDSRSQKLLVARDRMGIKPLYVARSDHGIRFASNTRALLDSGGVDTALDPEAL
HLLFSLHAVVPAPRTVLRGIRKLQPGHYLLIEADGHEHLECYWRLCARRPEQGVDDDEWR
ERIEAGLRRAVRRRLEVADVPVGVLLSGGLDSSLLVALATEEGAQNLRTFTVGFEDQPEE
KGSEFEYSDPVAERYATDHQRTLIPNSEVLRRLPEAVAAMSEPMFGQDAVAFYLLAEQVS
QHVKVVQSGQGADEVFGGYFWYPKMAEERSGGWTERFRKHYFDRDDPEMRELLARPPQGD
VTGDWLHAELAALETDRADSFIDAVLALDVTTLIVDDPVKRVDNMTMAFGLEARVPFLDH
ELVETAAAMPPHLKLGDGGKKVLKQIARGRLPDAVLDRPKGYFPVPALKYVRGEFLEFMR
DILGSQAARERGIYRPGYVQRLLDAPDQHFTRIQGSKLWHLALLEFWLQTQVDTA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattgcgggtgagttcgtctggggcgaccggcgcgcggacgtggatgcggtc
gcgcggatgctgcccgcgctggcacggcgggggccggatgcggacggtgtctgggccgcg
ggccgggtggcgctggggcaccgccggctatccatcctggatctctcgcagcgtgcgcac
cagccgatgttcgaccccgcaaccgggctcgcgctggtgttcaacggcgcgatctacaat
ttccgtacgctgcgcgccgaactggaacggcgcgggcaccgcttcttctccaccggcgat
accgagaccatccttcggggctacgcggagtggggcgaggcggtggtgggccggctgcac
ggcatgttcgctttcgcgctgttcgattccagaagccagaagctgctggtcgcgcgtgac
cgcatggggatcaagccgctctacgttgcgcgctcggaccacgggatccggttcgcttcg
aatacccgggcactgctggacagcggaggtgtcgataccgcgctggatcccgaggcgctg
catctgctgttctcgctgcatgcggtggtacccgcgccgcgcaccgtgctacgcgggatc
cgcaagctgcagccggggcattacctgctgatcgaggccgacggccacgaacacctggaa
tgctactggcggctctgtgcgcggcgcccggaacagggggtcgacgacgacgaatggcgc
gaacgcatcgaggccgggctgcgccgggcggtccggcggcggctggaggtggccgacgtg
ccggtgggtgtactgctttcgggcggactcgactccagcctgctggtcgcgctggcgacc
gaggagggggcgcagaacctgcgtaccttcaccgtgggcttcgaggatcagccggaggag
aagggctccgagttcgagtattcggacccggtggccgagcgctatgcgaccgaccaccag
cgcacgctgattccgaacagcgaggtgctccgccgcttgcccgaggcggtggcggcgatg
tccgagccgatgttcgggcaggatgcggtggcgttctacctgctcgcggagcaggtctcc
cagcacgtgaaggtcgtgcagtcgggccagggtgcggacgaggtgttcggggggtacttc
tggtacccgaaaatggccgaggagcgttcgggcggctggaccgagcgctttcgtaaacac
tatttcgaccgcgacgacccggagatgcgcgaactgctcgcccggccgccgcagggcgac
gtgaccggcgactggctgcacgccgaactggctgcactggagaccgatcgcgccgacagc
ttcatcgacgcggtgctggcgctcgatgtgaccacgctgatcgtcgacgatccggtgaag
cgggtcgacaacatgaccatggccttcgggctcgaggcccgggtgccgttcctggaccac
gaactggtcgagaccgcggcagcgatgccgccgcacctgaagctcggggacggtggcaag
aaggtactgaagcagatcgcgcgtgggcggttgccggacgcggtgctggaccggccgaag
ggctacttcccggtgcctgcgctgaagtacgtgcgcggcgagttcctggagttcatgcgc
gatatcctcggttcgcaggcggcacgcgagcgcggcatctaccgaccaggttacgtgcag
cgcctgctcgacgcgcccgaccagcacttcacgcgcatccagggatccaagctctggcat
ctggcgctgctcgagttctggctgcagacccaggtggataccgcctga

DBGET integrated database retrieval system