KEGG   Thioalkalivibrio nitratireducens: TVNIR_1265Help
Entry
TVNIR_1265        CDS       T02408                                 

Gene name
glgB_[H]
Definition
1,4-alpha-glucan (glycogen) branching enzyme, GH-13-type (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TVNIR_1265 (glgB_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TVNIR_1265 (glgB_[H])
Exosome [BR:tni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVNIR_1265 (glgB_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1212940..1215048)
Genome map
AA seq 702 aa AA seqDB search
MDHQTVCCRSFLPRAREAWLLCGGADALHREPMTPSPDLPGLFTWTGALADCPLHPTILW
SEGGGQTFQAVDPYSFPPHISGFDLHLFGEGRHWHAHRMMGAHPEVRDGIPGVRFAVWAP
GAERVSVVGDFNHWDGRSHPMSVHGGSGVWELFIPGLPDGALYKFEIRNRESGQIFVKSD
PYGAFFEMRPNTSSRVFASRGYEWSDDAWLQRRSAPNAWKHRPMSIYEVHLGSWKRGVAG
RFLGYRELADELIPYVRDRGFTHIELLPVTEHPFDGSWGYQSTGFFAPTSRFGTPDDFRH
LVDSAHRAGIGVLLDWVPGHFPKDAFALARFDGTALYEHEDPRKGEHRDWGTLIFNYGRS
EVRNFLLSSALCWIEDFHIDGLRVDAVASMLYLDYSRQANDWIPNEYGGNENLDAIAFLR
ELNRTIQGNHPGVLMIAEESTAWPGVSRPPETGGLGFTMKWNMGWMHDTLAYFQLDPIHR
RHHHNQLTFGMLYAYTENFVLPFSHDEVVHGKRTLRGRMPGDESQQHAQLRLLYAYQWTY
PGKKLLFMGQEFGQGTEWSEDRELDWYILQYPLHQGMTTLVRDLNHLYRNEPTLHAAEFE
PEGFAWLDCDDASRSVLSFLRRGGDSQMIVVLNLTPVPREDYAIPAPHGGLWTVRLNTDS
EFYGGGSRGSLQARAEARPLRGFTHTLRLDLPPLAALILAPG
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtggaccaccagacagtctgctgtcgcagcttcctgccgcgcgcacgcgaggcctggctg
ctgtgtggcggggccgatgctctgcaccgcgaaccgatgaccccgagccccgacctgccc
ggcctgttcacctggaccggcgccctggcggactgccccctgcatccgacgatcctctgg
tcggagggtggcggccaaacgtttcaggccgttgacccttatagctttccaccgcacatt
tccgggttcgacctgcacctgttcggcgaggggcggcactggcatgcccaccgcatgatg
ggggcccacccggaagttcgcgatggcatcccgggcgtccgcttcgcggtctgggcaccg
ggcgctgagcgcgtcagcgtggtgggtgacttcaaccactgggacggccgcagccacccg
atgtcggtgcacggcggcagcggcgtctgggaactgttcatccccggcctgcccgacggc
gcactgtacaaattcgagatccgcaaccgcgagtccggccagattttcgtgaaaagcgac
ccgtacggcgcattcttcgagatgcgcccgaacacctcgagccgcgtcttcgccagccgg
ggatacgaatggagcgacgacgcctggctgcagcggcgcagcgccccgaacgcgtggaaa
caccggccgatgagcatctacgaggtgcatctcggatcctggaagcgcggggtcgctggc
cgcttcctcggctaccgcgaactcgccgacgaactgatcccctacgtgcgcgaccgtgga
ttcacccatatcgaactgttgccggtgaccgaacacccgttcgacggctcctggggctac
cagagcaccggcttcttcgcccccacgtcgcgattcggcacgcccgacgatttccgccac
ctggtcgacagcgcgcaccgggccgggatcggcgtgttgctggactgggtgccggggcat
tttccgaaggacgctttcgctctggcccgcttcgacggcaccgcactctacgagcacgag
gacccgcgcaagggcgaacaccgtgactggggcacgctgatcttcaactacgggcgttcg
gaagttcgcaacttcctgctgtcgagcgcattgtgctggatcgaggacttccacatcgac
ggcctgcgcgtcgatgcggtggcctcgatgctgtacctcgactactcgcgccaggccaac
gactggatcccgaacgagtacggcggcaacgaaaacctcgacgcaatcgcgttcctgcgc
gaactgaaccgtaccatccagggcaaccaccccggcgttctgatgatcgccgaggaatcg
accgcctggcccggcgtcagccggccgccggagaccggcggactggggttcacgatgaaa
tggaacatgggctggatgcacgacacgctggcctatttccagctggatccgatccaccgc
cggcaccatcacaaccagctgactttcgggatgctgtatgcctacacggaaaacttcgtg
ctgcccttctcgcacgacgaagtggtacatggcaagcgtaccctgcgcggacggatgccg
ggcgacgagtcgcagcagcacgcccagctgcgcctgctgtatgcgtaccagtggacctac
cccggcaagaaactgctgttcatggggcaggagttcggccagggcaccgagtggagcgaa
gaccgcgaactcgactggtacatcctccagtacccgctgcatcagggcatgaccacgctg
gtgcgcgacctgaatcacctgtaccggaacgagcccacgctgcatgccgccgagttcgaa
cccgagggcttcgcctggctcgactgcgacgatgccagccgttccgtgctcagctttctg
cgccgcggaggcgattcgcagatgatcgtcgtgctgaacctcaccccggttccgcgcgag
gactatgcgattcccgcacctcacggcggtctctggacggtccgtctgaacaccgactcc
gagttctacggcggcggctcgcgcggctcgctgcaggcccgggccgaggcccgcccgctt
cgcggtttcacgcataccctgcgcctggatctgccgccgctggccgcactgatcctggca
ccgggctga

DBGET integrated database retrieval system