KEGG   Thioalkalivibrio nitratireducens: TVNIR_1270Help
Entry
TVNIR_1270        CDS       T02408                                 

Gene name
malQ_[H]
Definition
4-alpha-glucanotransferase (amylomaltase) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TVNIR_1270 (malQ_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TVNIR_1270 (malQ_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1218256..1219734
Genome map
AA seq 492 aa AA seqDB search
MSVPGAPVNRLLEKRRSGILLHPTSLPGPGPVGRLGDEARRFVDWMVSAGFSVWQILPVN
PPQQGGSPYACISAFAGDTRLIDPGMLVEAGWLPPGSERWPLGQALSEARAALMADGGDD
WQDYLRFCHDQDDWLDDFALFVVIKRLESGRPWWQWPEPLRDWSARRLEQLRAEMPEALD
AVRFGQFVFFRQWRALREYANARDVLLLGDMPIFVAHDSADVWAHPDDFDLDAKGQPNTV
TGVPPDYFSETGQRWGNPQFRWGRMKEAGYAWWLRRIEWALAGVDALRIDHFRGFESYWS
IPASEPTAIAGQWEPGPGADFFEALLARFGELPLLAEDLGVITPEVTALRDRFGLPGMMI
LQFAFDGGDDNPYLPQNHVQCGVVYTGTHDNDTTVGWFEALEPERRAHVLEVLGNPAEPM
PWALVRAALTSPAQVAIIPMQDALALDGRHRMNTPGTSDGNWTWRFDWSQVPDRRAEELR
QMNEEAGRIPAV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgcccggggcgccggtcaaccggctgctggagaagcgcaggtcgggcattctc
ctgcaccccacgtcgctgcccgggcctggcccggtggggcggttgggcgatgaagcgcgg
cggttcgtggactggatggtgagcgccgggttcagcgtctggcagatccttccggtcaat
ccgccgcagcagggcggttctccgtacgcgtgcatctcggccttcgcgggtgatacccgg
ctaatcgatccgggaatgctcgtcgaggccggatggctgcctcccgggtcggagcgctgg
ccactgggacaggcgctgtcggaggcccgggcggcactgatggccgacggaggcgacgac
tggcaggactaccttcggttctgccacgatcaggacgactggctggacgatttcgcgctg
ttcgtcgtgatcaagcggctcgagagcggtcggccctggtggcagtggccggagccgttg
cgcgactggtcggcccgccggctggagcagcttagggccgagatgcccgaggcgctggat
gcggtgcgtttcgggcagttcgtctttttccggcaatggcgcgcgctgcgcgagtatgcc
aatgcccgcgacgtcctgctgctcggcgacatgccgatcttcgtggcgcacgactccgct
gatgtctgggcgcacccggacgatttcgatctcgatgccaaaggccagccgaacaccgtg
acgggtgtgccgcccgattatttttcggagaccgggcagcgctggggcaacccgcaattc
cgctggggccggatgaaagaggcgggctacgcatggtggctgcgccgtatcgagtgggcg
ctggccggtgtcgacgcgctgcggatcgatcatttccggggcttcgagtcctactggtcg
atcccggccagcgagccgaccgcgatcgcggggcaatgggagcccggacccggtgccgac
ttcttcgaggccctgctcgcgcgcttcggtgaactgccgctgctggccgaggatctgggc
gtgatcacgcccgaggtgacggctttgcgcgatcgcttcggcctgccggggatgatgatc
ctgcagttcgcgttcgacggaggagacgacaacccctatctgccgcagaaccacgtccag
tgcggggtcgtctacaccggcacgcatgacaatgacaccaccgtcggctggttcgaggcg
ctggagccggagcgccgcgcgcatgtgctcgaggtgctgggcaatcccgccgagccgatg
ccctgggcgctggtgcgggcggcactgacctcgccggcgcaggtcgcgatcatcccgatg
caggatgccctggccctggatggccgccatcggatgaacaccccgggaacgagcgatggc
aactggacctggcggttcgactggtcacaggtgccggacaggcgcgcggaggaactgcgc
caaatgaacgaggaagctggccgtattcccgcggtgtga

DBGET integrated database retrieval system