KEGG   Thioalkalivibrio nitratireducens: TVNIR_1325Help
Entry
TVNIR_1325        CDS       T02408                                 

Gene name
glpK_[H]
Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tni00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1282228..1283730)
Genome map
AA seq 500 aa AA seqDB search
MLAIDAGTTGVTAIVFDHRGRVCSRAYAEFTQHYPRAGWVEHDAEEILMVTLRVIGEALR
DGRIRSDDLQGIGITNQRETVVLWDRASGQPLGRAIVWQDRRTAKFCDALRDRGLEAWLQ
ERTGLLIDPYFSATKLHWLLEQDPDLRERARSGTIAFGTIDSWLVFRLSGLRAHVTDYSN
ASRTQLYNLHELRWDPDILDLLDIPAALLPEVMPSSWIYAHTDPELFPGSRPIPIAGIAG
DQQAALFGQACHEPGMAKNTYGTGSFVLQHTGTTAVPSRQRLLTTIAWGIGDEPVEYAQE
GAIFVTGAAVQWLRDGLGMIASATETEALARSVADNEGVYFVPALTGLGAPHWDPHARGL
LIGLTRGTGKAQVARAVLESIAYQTRDVLEAMQRDSGIRLSELRCDGGAALNPVLMQFQA
DILDSSVVVPETVETTALGAAYLAGLATGFWGDRTELARHWRVRNRYTPGLPEPERERLY
RRWLRAVDLSRGWAREDTDS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcgatcgacgctggcacgaccggtgtcaccgcaatcgtgttcgatcaccggggg
cgggtttgcagccgggcctacgcggagttcacgcaacactatccgcgcgccggctgggtg
gaacacgatgccgaggagatcctgatggttacgctgcgggtgatcggcgaggcgctgcgc
gacggccgcattcgctccgacgacctgcagggtatcgggatcaccaaccagcgcgagacc
gtggtgctgtgggatcgggccagcgggcaaccgctggggcgcgcgatcgtctggcaggac
cggcggaccgccaaattctgcgacgcactgcgcgaccgggggctggaagcctggctgcag
gagcgcacgggtctgttgatcgacccgtacttctcggccaccaagctgcactggctgctg
gaacaggatccggatctgagggagcgtgcgcgcagcggcacgatcgcgttcggtaccatc
gattcatggctggtgttccgactgagcgggctacgcgcgcacgtgaccgattactcgaat
gcgtcgcgcacgcagctgtacaacctccacgagctgcgctgggacccggacatcctggat
ctgctggacattcccgcggcgctgctgcccgaagtgatgccgtcgtcgtggatctatgcg
cataccgaccccgagctttttcccggcagcaggccgattccgatcgcaggaatcgccggc
gaccagcaggcggcactcttcggccaggcctgccacgaaccgggcatggccaagaacacc
tatggcaccggatccttcgtgctgcagcataccggcaccaccgccgtgcccagccgccag
cgcctgctgaccacgatcgcctggggcatcggcgacgagcccgtggagtatgcccaggag
ggtgcgatcttcgtcaccggggcggccgtgcagtggcttcgggacgggctgggaatgatc
gcctcggccacggagaccgaggcgctcgcgcgttccgttgccgacaacgagggtgtctac
ttcgtaccggcgctgaccgggctcggggcaccgcactgggatccgcatgcccgaggcctg
ctgattggcctcacccgcggcacggggaaggcgcaggtggccagggcggtgctggagagc
attgcctaccagacccgggacgtgctggaggcgatgcagcgggattcggggatccggctc
tcggagttgcgctgtgacggcggcgcggcgctaaacccggtgctgatgcagttccaggcc
gacatcctggacagttcggtggtggtgccggaaacggtcgagaccaccgcgctcggggcg
gcctaccttgcgggactggcgacgggtttctggggcgaccgtacggaactggcacgccac
tggcgggtacgcaatcggtacacgccgggcctgcccgagccggaacgcgaacggctgtac
cggcgctggctgcgcgcggtcgatctgtcccgcggctgggcacgcgaggacacggattcg
tga

DBGET integrated database retrieval system