KEGG   Thioalkalivibrio nitratireducens: TVNIR_1344Help
Entry
TVNIR_1344        CDS       T02408                                 

Gene name
pcm2_[H]
Definition
Protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tni  Thioalkalivibrio nitratireducens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1302338..1303030
Genome map
AA seq 230 aa AA seqDB search
MVSSRKQRIDTLVAEVEREFQETSGSTGISAPDARLVEALRRVPRDAFVPDDSARFAWEN
RALSIGHGQTISQPFVVALMTQLLELTPESRVLEIGTGSGYQAALLAELAQEVFSIEVVP
ELARSAAENLQRQGYRNVRVRAGDGRRGWPEAAPFDAVIVTAGAESIPPALVEQLKPGGH
LVIPVDSHWLGQDLVLVTRGADGTLHRRAVLSVIFVPLVGGEGGTVDPWS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagttcacgaaagcaacggatcgatacactggttgccgaagtggaacgcgagttc
caggagacgtccggcagcaccggaatctccgcgccggatgcccggttggtcgaggcgctg
cgacgggtgccgcgcgatgccttcgtgcccgacgacagcgcgcgtttcgcctgggagaac
cgtgcgctgtcgatcgggcatggccagacgatctcgcagccgttcgtggtggcactgatg
acccagctgctcgaactgacccccgagagtcgggtgctggagatcggcacgggttccggt
tatcaggccgcactgctcgcggaactggcgcaggaggtgttcagcatcgaggtggtgccc
gagctggcccgatccgctgccgagaatctgcagcggcaggggtaccggaacgtgcgggtc
cgggcgggcgacggccgtcgtggctggcccgaggcggcgccgttcgatgcggtgatcgtt
acagccggagcagaatcgatccccccggcgctggtcgagcagctgaagccgggggggcac
ctggtgatcccggtcgattcccactggctcgggcaggatctggtgctggttacccgcggc
gccgatggaacgctgcaccgccgcgccgtgctttcggtgatcttcgtgccgctggtcggc
ggggagggtggcacggtggacccctggagttga

DBGET integrated database retrieval system