KEGG   Thioalkalivibrio nitratireducens: TVNIR_1444Help
Entry
TVNIR_1444        CDS       T02408                                 

Definition
Succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVNIR_1444
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TVNIR_1444
   00650 Butanoate metabolism
    TVNIR_1444
  Energy metabolism
   00190 Oxidative phosphorylation
    TVNIR_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1418628..1418966
Genome map
AA seq 112 aa AA seqDB search
MSLLGGQRAWLLQRVTAVYAGVYLLGAVALLLVRPPADHGAWLALVAHPAVWLATALFVL
VLLLHAWVGLRDVILDYLKPAWVRLTVLTLAAGVFLVMGFWALWILIDAVLR
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgctgggcgggcagcgagcctggctgctgcagcgggtcaccgcggtctacgcg
ggcgtctacctgttgggcgcggtagcgttgctgcttgtgcgcccaccggcggatcacggt
gcctggctggcgctggtcgcgcatccggccgtttggctggccacggcgctgttcgtgctg
gtgctgctgctacacgcctgggtcgggctgcgtgacgtgatcctcgactacctgaaaccg
gcctgggttcggctcactgtgctgacgctggcggcaggagtcttcctggtgatggggttc
tgggccctgtggatcctgatcgacgcggtgctccgatga

DBGET integrated database retrieval system