KEGG   Thioalkalivibrio nitratireducens: TVNIR_1555Help
Entry
TVNIR_1555        CDS       T02408                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tni  Thioalkalivibrio nitratireducens
Brite
Enzymes [BR:tni01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TVNIR_1555
Secretion system [BR:tni02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   TVNIR_1555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1545111..1545629)
Genome map
AA seq 172 aa AA seqDB search
MRSLISLMLSMALLSPGPLVWASPSAQEALQERVWSLPEEELIIFSPEQPRFEVTVFTDV
NCPFCRELHRHIEDFMIWDIRIRYAAFPTIGNALEQMEAVWCSENHHDAMTRAKRGEIVE
APACENPVADHLDLALSAGFFGTPAIVTPAGQVLYGRTSAASLVEVLKREAR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcactgatctctctgatgctctccatggccttgctgagcccgggaccgctggtc
tgggcctctcccagtgcccaggaggcactgcaggagcgcgtgtggtcgttgcccgaggag
gagctgatcatcttctcgcccgagcagcctcgcttcgaggtcacggtgtttaccgacgtc
aactgccccttctgccgagaactgcaccgccacatcgaggacttcatgatctgggacatc
aggattcgctatgctgcctttccgacgatcggcaacgcgctcgagcagatggaggcggtg
tggtgcagcgagaatcaccatgacgcgatgacgcgagccaagcgtggagaaatcgtggag
gcgccggcgtgcgaaaacccggtggcggatcacctcgatctggctttgtcggccgggttc
tttggcacgcccgcgatcgtcactcccgcagggcaagtgctctatggccgcacatcggcg
gcgtcgctggtcgaggtcctcaagcgcgaggctcggtga

DBGET integrated database retrieval system