KEGG   Thioalkalivibrio nitratireducens: TVNIR_1608Help
Entry
TVNIR_1608        CDS       T02408                                 

Gene name
nagZ_[H]
Definition
Beta N-acetyl-glucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TVNIR_1608 (nagZ_[H])
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TVNIR_1608 (nagZ_[H])
Enzymes [BR:tni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TVNIR_1608 (nagZ_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1599813..1600868)
Genome map
AA seq 351 aa AA seqDB search
MRTRYEAMSEFLGPVMLGITGLELTPEDRERLLHPATGAVILFTRNYEDPEQLRALIGAI
RSLRRPELLLAVDHEGGRVQRFRTGFTELPPMRRIGDVFSYDPPRGQELARDAGWLLAQE
LKAVGLDFSFTPVLDRDAGISEVIGDRAFHDRADVIARLGGYLLDGLDEAGMSGVGKHFP
GHGGVAADSHEEVPVDPRPFAEIEADDIAAFLPLLPRLGGIMPAHVIYPDVDSNPAGFSG
IWLHDLLRMRWGFDGALFSDDLGMAGARAAGSPADRAHAALYAGCDMVVICNDFAAADEI
LQTLEGRDPNPDTQRRLEAMRARPAAEDRARMEAAQSRLLALGDHEPTYIT
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaacccggtatgaagccatgagcgaattcctgggcccggtgatgctgggtataacg
ggtctggaactgaccccggaagaccgcgagcgcctgctgcacccagcgacgggcgccgtc
atcctgttcacccggaattacgaggaccccgaacaactccgggcactgatcggtgcgatc
cgctccctgcggcggccggaactgctgctggcggtggatcacgagggcgggcgggtgcag
cgctttcgcacggggttcaccgaactgccgccgatgcgccgcatcggcgacgtgttctcc
tacgatccaccccggggtcaggaactggcacgggatgctggatggcttcttgcccaggaa
ctgaaggcagtgggcctggatttcagcttcacccccgtgctcgaccgcgacgctggcatc
agcgaggtgatcggagaccgcgcctttcatgatcgggcggacgtgatcgcccggctcggc
ggctatctgctggacggacttgacgaggccggaatgtccggggtcggcaagcattttccg
ggacacggcggcgtcgcggcggactcgcacgaggaagtgccggtggacccgcgcccgttc
gcggaaatcgaggccgacgacatcgcggcctttctcccgttgttgccgcgcctgggcggc
atcatgccggcgcatgtcatctatcccgacgtggattcgaatcccgcgggtttctcgggg
atctggctgcacgacctgctgagaatgcgctggggcttcgacggcgcgctgttcagcgac
gatctgggcatggccggcgcccgggccgcaggttcgcctgccgaccgggcgcatgcggca
ctgtacgccggctgcgacatggtcgtgatctgcaacgatttcgccgcggcggacgagatc
ctgcagacgttggaaggacgcgatccgaaccccgacacgcagcgccggctcgaggccatg
cgtgcccgcccggcggcggaggaccgcgcgcgtatggaggccgcacagtcccggttgctg
gcactgggcgaccacgaacccacctacatcacctga

DBGET integrated database retrieval system