KEGG   Thioalkalivibrio nitratireducens: TVNIR_1638Help
Entry
TVNIR_1638        CDS       T02408                                 

Gene name
nosZ_[H]
Definition
Nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    TVNIR_1638 (nosZ_[H])
Enzymes [BR:tni01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     TVNIR_1638 (nosZ_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1636804..1638699
Genome map
AA seq 631 aa AA seqDB search
MNDEQDQDKKSGVSRRGFLGATAVAGAAGAGLASGLLGFGAGEAQARARNSGLEFHVAPG
ELDTYYGFWSGGQSGEIRILGIPSQRELMRIPVFNHESATGWGKTNESKRVLNGSPHTNG
DTHHVHLSYENGTYDGRYAFVNDKLNTRVARIRLDIMKPDRITEIPNVAAIHGINPQRWP
STEYLFCSGEMIIPLPNDGRHLDEPEHYWTLMTALDAETMDVKWQVWVDGNMDNLVTDYS
GKYVGATCYNSGRGVTLAEMMGPERDWAVFFNVPAIEKAVAEGDFTTIGDSPVPVVDGRG
AAEGGTAYTLYVPVPRSPHGLNSSPDKKYVIASGKLSPTVTIMEWSKVDDWFAGKLNDPR
DTVLAEPEVGLGPLHTTFDGRGNAYTSVFLDSQVVKWNIDDALRAARGEQVNYIRQKLDI
HYQIGHIMASMAETVEADGKWLVALNKFSKDRFIPVGPLRPENEQLIDISGEEMKLVHDG
PAFPEPHDVVMVRADLVRPARVWSRDDPFFAETAERARQDGVDLERDNTVIRDGNKVRVY
MTSLAPNFGLTEFSVKQGDEVTVTVTNLDRIEDVAHGFALVNHGVNMEISPQQTASITFA
ANKPGVHWYYCSWFCHALHMEMSGRMLVESA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgaacaggatcaggacaagaagtctggcgtaagccgacgggggttcctgggg
gctaccgccgtggccggtgcagcgggggcaggtctggcgtccggcctgctcggatttggc
gctggcgaggcgcaggcgcgtgcgcgcaactcggggctggagtttcacgtcgcgccgggc
gaactcgacacctattacggcttctggagcggcggacagtcgggcgagatccggattctc
gggatcccgtcccagcgcgaactgatgcgcatccccgtgttcaaccacgagagcgccacc
ggctggggcaagaccaacgagagcaagcgtgtgctgaacggcagcccgcacaccaacggc
gacactcaccacgtgcatctgagctacgagaacggcacctacgacggccggtacgcgttc
gtcaacgacaagctgaacacccgggtggcccggatccggctcgacatcatgaagccggac
aggatcaccgagatccccaacgtcgccgcgatccacggcatcaacccgcagcgctggccc
agtaccgagtatctcttctgcagcggcgaaatgatcatcccgttgccgaacgacgggcgg
cacctggacgagccggagcactactggacattgatgaccgcgctcgatgccgagaccatg
gatgtgaagtggcaggtctgggtcgacggcaacatggacaacctggtcaccgactacagc
ggcaagtatgtcggcgcgacctgctacaactccggccgtggcgtaacgctggccgagatg
atgggccccgaacgcgactgggcggtgttcttcaacgttcccgcgatcgagaaagcggtt
gccgagggcgacttcacgaccatcggggattcgccggttccggtcgtcgacggtcgcggt
gccgcggaggggggcaccgcctacacgctctatgtgcccgtgccccggagtccacacggc
ctgaactcgagcccggacaagaaatacgtgatcgcgtcgggcaagctctcgcccaccgta
acgatcatggagtggtcgaaggtcgacgattggttcgcgggcaaactcaacgatccacgc
gacaccgtgctggccgaacccgaggtcggcctcgggccgctacacacgaccttcgacggc
cgcgggaacgcctacacctcggtgttcctcgacagccaggtggtgaagtggaacatcgac
gacgcgctccgtgccgcacgcggcgagcaggtgaactacatccggcagaagctcgatatc
cactatcagatcggtcacatcatggcaagcatggccgagaccgtcgaggccgacggcaag
tggctggtcgcgctgaacaagttctcgaaggaccgcttcatcccggtgggcccgctgcgg
ccggagaacgagcagctgatcgacatctccggcgaggagatgaaactggtccatgacggc
ccggccttccctgagccgcacgacgtggtgatggtgcgggcggacctggtgcgccccgcc
cgcgtctggtcgcgcgacgacccgttcttcgcggaaaccgcggagcgggcacgccaggac
ggggtggatctcgaacgcgacaacacggtcatccgcgacggcaacaaggtccgtgtctac
atgaccagcctggcgccgaacttcggtctcaccgagttcagcgtgaaacagggcgacgag
gtcacggtgacagtaaccaacctcgaccgcatcgaggatgtcgcacacggcttcgcgctg
gtgaaccacggcgtgaacatggagatcagcccgcaacagaccgcgtcgatcaccttcgcc
gcgaacaaacccggggtgcactggtactactgcagctggttctgccatgcgctgcacatg
gagatgtccggacgcatgctggtcgagtcggcctga

DBGET integrated database retrieval system