KEGG   Thioalkalivibrio nitratireducens: TVNIR_1638Help
Entry
TVNIR_1638        CDS       T02408                                 

Gene name
nosZ_[H]
Definition
(GenBank) Nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00910  Nitrogen metabolism
tni01120  Microbial metabolism in diverse environments
Module
tni_M00529  Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    TVNIR_1638 (nosZ_[H])
Enzymes [BR:tni01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     TVNIR_1638 (nosZ_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX2 Cupredoxin_1 Cu-oxidase_3 UCR_Fe-S_N TAT_signal
Motif
Other DBs
NCBI-ProteinID: AGA33304
UniProt: L0DUN0
Position
1636804..1638699
Genome map
AA seq 631 aa AA seqDB search
MNDEQDQDKKSGVSRRGFLGATAVAGAAGAGLASGLLGFGAGEAQARARNSGLEFHVAPG
ELDTYYGFWSGGQSGEIRILGIPSQRELMRIPVFNHESATGWGKTNESKRVLNGSPHTNG
DTHHVHLSYENGTYDGRYAFVNDKLNTRVARIRLDIMKPDRITEIPNVAAIHGINPQRWP
STEYLFCSGEMIIPLPNDGRHLDEPEHYWTLMTALDAETMDVKWQVWVDGNMDNLVTDYS
GKYVGATCYNSGRGVTLAEMMGPERDWAVFFNVPAIEKAVAEGDFTTIGDSPVPVVDGRG
AAEGGTAYTLYVPVPRSPHGLNSSPDKKYVIASGKLSPTVTIMEWSKVDDWFAGKLNDPR
DTVLAEPEVGLGPLHTTFDGRGNAYTSVFLDSQVVKWNIDDALRAARGEQVNYIRQKLDI
HYQIGHIMASMAETVEADGKWLVALNKFSKDRFIPVGPLRPENEQLIDISGEEMKLVHDG
PAFPEPHDVVMVRADLVRPARVWSRDDPFFAETAERARQDGVDLERDNTVIRDGNKVRVY
MTSLAPNFGLTEFSVKQGDEVTVTVTNLDRIEDVAHGFALVNHGVNMEISPQQTASITFA
ANKPGVHWYYCSWFCHALHMEMSGRMLVESA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgaacaggatcaggacaagaagtctggcgtaagccgacgggggttcctgggg
gctaccgccgtggccggtgcagcgggggcaggtctggcgtccggcctgctcggatttggc
gctggcgaggcgcaggcgcgtgcgcgcaactcggggctggagtttcacgtcgcgccgggc
gaactcgacacctattacggcttctggagcggcggacagtcgggcgagatccggattctc
gggatcccgtcccagcgcgaactgatgcgcatccccgtgttcaaccacgagagcgccacc
ggctggggcaagaccaacgagagcaagcgtgtgctgaacggcagcccgcacaccaacggc
gacactcaccacgtgcatctgagctacgagaacggcacctacgacggccggtacgcgttc
gtcaacgacaagctgaacacccgggtggcccggatccggctcgacatcatgaagccggac
aggatcaccgagatccccaacgtcgccgcgatccacggcatcaacccgcagcgctggccc
agtaccgagtatctcttctgcagcggcgaaatgatcatcccgttgccgaacgacgggcgg
cacctggacgagccggagcactactggacattgatgaccgcgctcgatgccgagaccatg
gatgtgaagtggcaggtctgggtcgacggcaacatggacaacctggtcaccgactacagc
ggcaagtatgtcggcgcgacctgctacaactccggccgtggcgtaacgctggccgagatg
atgggccccgaacgcgactgggcggtgttcttcaacgttcccgcgatcgagaaagcggtt
gccgagggcgacttcacgaccatcggggattcgccggttccggtcgtcgacggtcgcggt
gccgcggaggggggcaccgcctacacgctctatgtgcccgtgccccggagtccacacggc
ctgaactcgagcccggacaagaaatacgtgatcgcgtcgggcaagctctcgcccaccgta
acgatcatggagtggtcgaaggtcgacgattggttcgcgggcaaactcaacgatccacgc
gacaccgtgctggccgaacccgaggtcggcctcgggccgctacacacgaccttcgacggc
cgcgggaacgcctacacctcggtgttcctcgacagccaggtggtgaagtggaacatcgac
gacgcgctccgtgccgcacgcggcgagcaggtgaactacatccggcagaagctcgatatc
cactatcagatcggtcacatcatggcaagcatggccgagaccgtcgaggccgacggcaag
tggctggtcgcgctgaacaagttctcgaaggaccgcttcatcccggtgggcccgctgcgg
ccggagaacgagcagctgatcgacatctccggcgaggagatgaaactggtccatgacggc
ccggccttccctgagccgcacgacgtggtgatggtgcgggcggacctggtgcgccccgcc
cgcgtctggtcgcgcgacgacccgttcttcgcggaaaccgcggagcgggcacgccaggac
ggggtggatctcgaacgcgacaacacggtcatccgcgacggcaacaaggtccgtgtctac
atgaccagcctggcgccgaacttcggtctcaccgagttcagcgtgaaacagggcgacgag
gtcacggtgacagtaaccaacctcgaccgcatcgaggatgtcgcacacggcttcgcgctg
gtgaaccacggcgtgaacatggagatcagcccgcaacagaccgcgtcgatcaccttcgcc
gcgaacaaacccggggtgcactggtactactgcagctggttctgccatgcgctgcacatg
gagatgtccggacgcatgctggtcgagtcggcctga

DBGET integrated database retrieval system