KEGG   Thioalkalivibrio nitratireducens: TVNIR_1801Help
Entry
TVNIR_1801        CDS       T02408                                 

Gene name
gtaB_[H]
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TVNIR_1801 (gtaB_[H])
   00052 Galactose metabolism
    TVNIR_1801 (gtaB_[H])
   00500 Starch and sucrose metabolism
    TVNIR_1801 (gtaB_[H])
   00520 Amino sugar and nucleotide sugar metabolism
    TVNIR_1801 (gtaB_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TVNIR_1801 (gtaB_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1802786..1803673)
Genome map
AA seq 295 aa AA seqDB search
MTKNEQRIRMAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAAEEAVAAGIETLVFV
TGRNKRSIPDHFDKAYELESELEQRGKTRMLELVRNILPPEVTCVYVRQADALGLGHAVG
CARPIVQHEPFAVILADDLIESERGGALAQMVEQFNDTQCSVLGVEEVPRQDTGKYGVID
PVATDTPGLWDVKGIVEKPRPEDAPSSMAVVGRYVLTPRIFELLKAQEPGAGGEIQLTDA
IARLLEQERVTAFEFSGRRFDCGSKLGYLQATVEFALQHPELSEDFKAYLDARRA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaatgagcagcgtattcgcatggcggtttttcccgtcgcagggatgggcacg
cgcttcctgccggcgaccaaggcgaatccgaaagagatgctgccgatcgtcgacaagccc
ttgatccagtatgcagcggaagaggcggtcgcggcgggaatcgagacactggtgttcgtg
actggacgcaacaagcgctcgattccggatcatttcgacaaggcctacgaactcgaaagc
gaactggaacagcggggcaagacccggatgctggaactggttcgaaacatcctcccgccc
gaggtgacctgcgtatatgttcggcaggcggatgccctcggcctcggccacgcggtcggc
tgcgcccggccgatcgtgcaacacgaaccctttgcggtgatcctcgccgacgacctgatt
gaaagcgagcggggcggtgcgctggcgcagatggtcgagcagttcaacgacacccagtgc
agcgtgctgggggtggaggaggtgccgcggcaggacaccggcaagtacggcgtgatcgac
ccggtggcgaccgataccccgggcctgtgggacgtgaaggggatcgtcgagaaaccccgg
cccgaggacgctccctccagcatggccgtcgtgggccgctacgtgctgacgccccgcatt
ttcgagttgctgaaggcgcaggagcccggagcgggaggcgagatccaactgaccgacgcg
attgcccgcctgctggagcaagagcgtgtcaccgccttcgaattctcgggcaggcgtttc
gattgcggaagcaagctggggtatctgcaggcgaccgtcgaattcgccctccagcacccg
gagttgagcgaagatttcaaggcctatctggacgcaagaagagcctga

DBGET integrated database retrieval system