KEGG   Thioalkalivibrio nitratireducens: TVNIR_1929Help
Entry
TVNIR_1929        CDS       T02408                                 

Gene name
rmlC_[H]
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    TVNIR_1929 (rmlC_[H])
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TVNIR_1929 (rmlC_[H])
Enzymes [BR:tni01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     TVNIR_1929 (rmlC_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1953267..1953833
Genome map
AA seq 188 aa AA seqDB search
MIVTAMRIPEVLRIEPKVFGDPRGYFMESYHAARYAEFGIPAAFVQDNVSASGRGILRGL
HLQNPHPQGKLVYVLEGEVFDVAVDVRVGSPTFGQWVGEYLSAANHRQLWVPEGFAHGFC
VTSERALFCYKCTDRYHPEAELSVRWDDPALGIDWPVREPRVSDKDAQAACLHAIDPAKL
PGYEGTAT
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgaccgcgatgcgcatccccgaggtgctgcggatcgaaccgaaggtgttcggc
gaccctcgcggttacttcatggaaagctaccacgccgcacgctatgccgagttcggaatc
cccgccgcattcgtgcaggacaacgtgtccgcgtctgggcgggggatcctgcgcggactg
cacctgcagaacccgcatcctcaagggaagctggtgtacgtgctcgagggcgaggtgttc
gacgtcgcggtcgatgtccgcgtgggttcgccaaccttcgggcagtgggtgggcgagtat
ctttctgccgcgaaccatcgccagctctgggttccggaaggattcgcccacgggttctgc
gtgaccagcgaacgcgcacttttctgctacaaatgcaccgatcgctatcacccggaggcc
gagctctccgttcgctgggatgatcccgcgctagggatcgactggccggtccgcgaaccc
cgcgtctcggacaaggatgcacaggccgcctgcctgcacgcgatcgatcccgcgaagctg
cccggttacgaaggaactgcaacgtga

DBGET integrated database retrieval system