KEGG   Thioalkalivibrio nitratireducens: TVNIR_2011Help
Entry
TVNIR_2011        CDS       T02408                                 

Gene name
porC_[H]
Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00010  Glycolysis / Gluconeogenesis
tni00020  Citrate cycle (TCA cycle)
tni00620  Pyruvate metabolism
tni00633  Nitrotoluene degradation
tni00640  Propanoate metabolism
tni00650  Butanoate metabolism
tni00680  Methane metabolism
tni01100  Metabolic pathways
tni01120  Microbial metabolism in diverse environments
tni01130  Biosynthesis of antibiotics
tni01200  Carbon metabolism
Module
tni_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVNIR_2011 (porC_[H])
   00020 Citrate cycle (TCA cycle)
    TVNIR_2011 (porC_[H])
   00620 Pyruvate metabolism
    TVNIR_2011 (porC_[H])
   00640 Propanoate metabolism
    TVNIR_2011 (porC_[H])
   00650 Butanoate metabolism
    TVNIR_2011 (porC_[H])
  Energy metabolism
   00680 Methane metabolism
    TVNIR_2011 (porC_[H])
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TVNIR_2011 (porC_[H])
Enzymes [BR:tni01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TVNIR_2011 (porC_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AGA33672
UniProt: L0DXD9
Position
2053271..2053840
Genome map
AA seq 189 aa AA seqDB search
MLEIRIHGRGGQGNVVAAYLLASAAIDGGRYAQAFPAFGAERRGAPVAAFVRIDEQPIRR
RCQVREPTFLIVQDPALMEVPGTLSGIRPDGTVLVDGPSGRIDDSGPNEVITMPATHLAM
EHIGRPVPNTALLAAFITLTGLMPLSALTDALGERFKGPILEKNRKLVEAAAETVEAGRW
REVAHAAGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagatcaggattcacggccgcggcggccagggcaacgtggtggcggcgtatctg
ctggcatctgcggcaatcgacggggggcgctacgcccaggcgttcccggcgtttggcgca
gagcgccgcggcgctccggttgccgcattcgtccgcatcgacgaacaaccgatccgccgc
cgctgccaggtccgggagccgaccttcctgatcgtccaggatccggcactgatggaagtc
ccgggaacactcagcgggatccgcccggatggcaccgtgctggtcgacgggccctccggc
cggatcgacgacagcggtcccaacgaggtgatcacgatgcctgcgacccatctcgcgatg
gaacatatcgggcgcccggtacccaacaccgcgctccttgccgccttcatcacgcttacc
gggctgatgccgctctcggcacttaccgatgcactcggtgagcggttcaaggggccgatc
ttggaaaagaatcgcaagctggtggaggcggccgccgaaaccgtcgaggctggacgctgg
cgggaggtggcccatgccgcaggcgcttga

DBGET integrated database retrieval system