KEGG   Thioalkalivibrio nitratireducens: TVNIR_2011Help
Entry
TVNIR_2011        CDS       T02408                                 

Gene name
porC_[H]
Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase, gamma subunit (EC:1.2.7.1)
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVNIR_2011 (porC_[H])
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVNIR_2011 (porC_[H])
   00020 Citrate cycle (TCA cycle)
    TVNIR_2011 (porC_[H])
   00620 Pyruvate metabolism
    TVNIR_2011 (porC_[H])
   00640 Propanoate metabolism
    TVNIR_2011 (porC_[H])
   00650 Butanoate metabolism
    TVNIR_2011 (porC_[H])
  Energy metabolism
   00680 Methane metabolism
    TVNIR_2011 (porC_[H])
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TVNIR_2011 (porC_[H])
Enzymes [BR:tni01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TVNIR_2011 (porC_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2053271..2053840
Genome map
AA seq 189 aa AA seqDB search
MLEIRIHGRGGQGNVVAAYLLASAAIDGGRYAQAFPAFGAERRGAPVAAFVRIDEQPIRR
RCQVREPTFLIVQDPALMEVPGTLSGIRPDGTVLVDGPSGRIDDSGPNEVITMPATHLAM
EHIGRPVPNTALLAAFITLTGLMPLSALTDALGERFKGPILEKNRKLVEAAAETVEAGRW
REVAHAAGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagatcaggattcacggccgcggcggccagggcaacgtggtggcggcgtatctg
ctggcatctgcggcaatcgacggggggcgctacgcccaggcgttcccggcgtttggcgca
gagcgccgcggcgctccggttgccgcattcgtccgcatcgacgaacaaccgatccgccgc
cgctgccaggtccgggagccgaccttcctgatcgtccaggatccggcactgatggaagtc
ccgggaacactcagcgggatccgcccggatggcaccgtgctggtcgacgggccctccggc
cggatcgacgacagcggtcccaacgaggtgatcacgatgcctgcgacccatctcgcgatg
gaacatatcgggcgcccggtacccaacaccgcgctccttgccgccttcatcacgcttacc
gggctgatgccgctctcggcacttaccgatgcactcggtgagcggttcaaggggccgatc
ttggaaaagaatcgcaagctggtggaggcggccgccgaaaccgtcgaggctggacgctgg
cgggaggtggcccatgccgcaggcgcttga

DBGET integrated database retrieval system