KEGG   Thioalkalivibrio nitratireducens: TVNIR_2013Help
Entry
TVNIR_2013        CDS       T02408                                 

Gene name
porB_[H]
Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00010  Glycolysis / Gluconeogenesis
tni00020  Citrate cycle (TCA cycle)
tni00620  Pyruvate metabolism
tni00633  Nitrotoluene degradation
tni00640  Propanoate metabolism
tni00650  Butanoate metabolism
tni00680  Methane metabolism
tni01100  Metabolic pathways
tni01120  Microbial metabolism in diverse environments
tni01130  Biosynthesis of antibiotics
tni01200  Carbon metabolism
Module
tni_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVNIR_2013 (porB_[H])
   00020 Citrate cycle (TCA cycle)
    TVNIR_2013 (porB_[H])
   00620 Pyruvate metabolism
    TVNIR_2013 (porB_[H])
   00640 Propanoate metabolism
    TVNIR_2013 (porB_[H])
   00650 Butanoate metabolism
    TVNIR_2013 (porB_[H])
  Energy metabolism
   00680 Methane metabolism
    TVNIR_2013 (porB_[H])
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TVNIR_2013 (porB_[H])
Enzymes [BR:tni01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TVNIR_2013 (porB_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N DUF983
Motif
Other DBs
NCBI-ProteinID: AGA33674
UniProt: L0DVP3
Position
2055026..2056018
Genome map
AA seq 330 aa AA seqDB search
MNEQPVYSLDTLRSRQPRFRGLESGHRACQGCGEALAARLTTEAAGPDVVVANATGCLEV
FSTPWPQSAWRLPWVHSVFGNVAAVAAGMEAALKQQGRATQVVAFAGDGGTFDIGFQALS
GMMERGHNVLFVCFDNEAYMNTGVQRSGSTPHAAMTTTSPPGKVRMGKRHMKKDILSIIA
AHHIPYAATASVAYTSDLRKKVRRAMDTEGASFLQIHSPCPLGWGHDGAATIEVARLAVQ
TGLFPIIEMERGELIGTLPIREPRPVSDYLRLQNRFRHLFADDYRARKELEHLQAIADRN
IERFELRGIRPESYDTEGADTVHRGGDRWA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacagcccgtctattccctcgacacgctgcgctcgcgccagccccgtttccgc
ggtctggaatccggccaccgcgcctgccagggctgcggcgaggcactcgccgcccggctg
acgaccgaggccgccggccccgacgtggtcgtggccaacgccactggctgcctcgaggtg
ttcagtaccccctggccccagtcggcctggcgcctgccctgggtccactccgtgttcggc
aacgtcgccgcggttgcggccggcatggaggccgcgctgaagcagcagggacgcgcgacc
caggtggttgccttcgccggcgacggcggcaccttcgacatcggcttccaggccctgtcg
gggatgatggagcgcggccacaacgtgctgttcgtctgcttcgacaacgaggcctacatg
aacaccggtgttcagcgctcggggtcgacgccgcatgcggcgatgacgaccacctccccg
ccgggcaaagtgcgcatgggcaagcgacacatgaagaaggacatcctctcgatcatcgcg
gcccaccatattccctatgccgccaccgcctcggtggcctacacgtcggacctgcgcaag
aaagtgcgccgcgcgatggataccgagggggcaagcttcctgcagatccattcgccctgc
ccgctcggctggggccacgacggtgccgccacgatcgaagtcgcacgcctggcggtgcaa
accggcctgttcccgatcatcgagatggaacgcggcgaactgatcggcacattgccgatc
cgggaaccgaggccggtctccgactacctgcggctgcagaaccgcttccgccacctgttt
gccgacgactaccgggcccggaaggaactggaacacctgcaggcgatcgccgatcgcaac
atcgaacgcttcgagttgcggggtatccggcccgagagttatgacaccgagggggccgac
acggtacaccgcggcggcgaccgctgggcctga

DBGET integrated database retrieval system