KEGG   Thioalkalivibrio nitratireducens: TVNIR_2013Help
Entry
TVNIR_2013        CDS       T02408                                 

Gene name
porB_[H]
Definition
Pyruvate:ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tni01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tni00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tni00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tni00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tni00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tni00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:tni00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:tni00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2055026..2056018
Genome map
AA seq 330 aa AA seqDB search
MNEQPVYSLDTLRSRQPRFRGLESGHRACQGCGEALAARLTTEAAGPDVVVANATGCLEV
FSTPWPQSAWRLPWVHSVFGNVAAVAAGMEAALKQQGRATQVVAFAGDGGTFDIGFQALS
GMMERGHNVLFVCFDNEAYMNTGVQRSGSTPHAAMTTTSPPGKVRMGKRHMKKDILSIIA
AHHIPYAATASVAYTSDLRKKVRRAMDTEGASFLQIHSPCPLGWGHDGAATIEVARLAVQ
TGLFPIIEMERGELIGTLPIREPRPVSDYLRLQNRFRHLFADDYRARKELEHLQAIADRN
IERFELRGIRPESYDTEGADTVHRGGDRWA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacagcccgtctattccctcgacacgctgcgctcgcgccagccccgtttccgc
ggtctggaatccggccaccgcgcctgccagggctgcggcgaggcactcgccgcccggctg
acgaccgaggccgccggccccgacgtggtcgtggccaacgccactggctgcctcgaggtg
ttcagtaccccctggccccagtcggcctggcgcctgccctgggtccactccgtgttcggc
aacgtcgccgcggttgcggccggcatggaggccgcgctgaagcagcagggacgcgcgacc
caggtggttgccttcgccggcgacggcggcaccttcgacatcggcttccaggccctgtcg
gggatgatggagcgcggccacaacgtgctgttcgtctgcttcgacaacgaggcctacatg
aacaccggtgttcagcgctcggggtcgacgccgcatgcggcgatgacgaccacctccccg
ccgggcaaagtgcgcatgggcaagcgacacatgaagaaggacatcctctcgatcatcgcg
gcccaccatattccctatgccgccaccgcctcggtggcctacacgtcggacctgcgcaag
aaagtgcgccgcgcgatggataccgagggggcaagcttcctgcagatccattcgccctgc
ccgctcggctggggccacgacggtgccgccacgatcgaagtcgcacgcctggcggtgcaa
accggcctgttcccgatcatcgagatggaacgcggcgaactgatcggcacattgccgatc
cgggaaccgaggccggtctccgactacctgcggctgcagaaccgcttccgccacctgttt
gccgacgactaccgggcccggaaggaactggaacacctgcaggcgatcgccgatcgcaac
atcgaacgcttcgagttgcggggtatccggcccgagagttatgacaccgagggggccgac
acggtacaccgcggcggcgaccgctgggcctga

DBGET integrated database retrieval system