KEGG   Thioalkalivibrio nitratireducens: TVNIR_2013Help
Entry
TVNIR_2013        CDS       T02408                                 

Gene name
porB_[H]
Definition
Pyruvate:ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVNIR_2013 (porB_[H])
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVNIR_2013 (porB_[H])
   00020 Citrate cycle (TCA cycle)
    TVNIR_2013 (porB_[H])
   00620 Pyruvate metabolism
    TVNIR_2013 (porB_[H])
   00640 Propanoate metabolism
    TVNIR_2013 (porB_[H])
   00650 Butanoate metabolism
    TVNIR_2013 (porB_[H])
  Energy metabolism
   00680 Methane metabolism
    TVNIR_2013 (porB_[H])
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TVNIR_2013 (porB_[H])
Enzymes [BR:tni01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TVNIR_2013 (porB_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2055026..2056018
Genome map
AA seq 330 aa AA seqDB search
MNEQPVYSLDTLRSRQPRFRGLESGHRACQGCGEALAARLTTEAAGPDVVVANATGCLEV
FSTPWPQSAWRLPWVHSVFGNVAAVAAGMEAALKQQGRATQVVAFAGDGGTFDIGFQALS
GMMERGHNVLFVCFDNEAYMNTGVQRSGSTPHAAMTTTSPPGKVRMGKRHMKKDILSIIA
AHHIPYAATASVAYTSDLRKKVRRAMDTEGASFLQIHSPCPLGWGHDGAATIEVARLAVQ
TGLFPIIEMERGELIGTLPIREPRPVSDYLRLQNRFRHLFADDYRARKELEHLQAIADRN
IERFELRGIRPESYDTEGADTVHRGGDRWA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacagcccgtctattccctcgacacgctgcgctcgcgccagccccgtttccgc
ggtctggaatccggccaccgcgcctgccagggctgcggcgaggcactcgccgcccggctg
acgaccgaggccgccggccccgacgtggtcgtggccaacgccactggctgcctcgaggtg
ttcagtaccccctggccccagtcggcctggcgcctgccctgggtccactccgtgttcggc
aacgtcgccgcggttgcggccggcatggaggccgcgctgaagcagcagggacgcgcgacc
caggtggttgccttcgccggcgacggcggcaccttcgacatcggcttccaggccctgtcg
gggatgatggagcgcggccacaacgtgctgttcgtctgcttcgacaacgaggcctacatg
aacaccggtgttcagcgctcggggtcgacgccgcatgcggcgatgacgaccacctccccg
ccgggcaaagtgcgcatgggcaagcgacacatgaagaaggacatcctctcgatcatcgcg
gcccaccatattccctatgccgccaccgcctcggtggcctacacgtcggacctgcgcaag
aaagtgcgccgcgcgatggataccgagggggcaagcttcctgcagatccattcgccctgc
ccgctcggctggggccacgacggtgccgccacgatcgaagtcgcacgcctggcggtgcaa
accggcctgttcccgatcatcgagatggaacgcggcgaactgatcggcacattgccgatc
cgggaaccgaggccggtctccgactacctgcggctgcagaaccgcttccgccacctgttt
gccgacgactaccgggcccggaaggaactggaacacctgcaggcgatcgccgatcgcaac
atcgaacgcttcgagttgcggggtatccggcccgagagttatgacaccgagggggccgac
acggtacaccgcggcggcgaccgctgggcctga

DBGET integrated database retrieval system