KEGG   Thioalkalivibrio nitratireducens: TVNIR_2210Help
Entry
TVNIR_2210        CDS       T02408                                 

Gene name
glk_[H]
Definition
Glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVNIR_2210 (glk_[H])
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVNIR_2210 (glk_[H])
   00052 Galactose metabolism
    TVNIR_2210 (glk_[H])
   00500 Starch and sucrose metabolism
    TVNIR_2210 (glk_[H])
   00520 Amino sugar and nucleotide sugar metabolism
    TVNIR_2210 (glk_[H])
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TVNIR_2210 (glk_[H])
   00524 Butirosin and neomycin biosynthesis
    TVNIR_2210 (glk_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TVNIR_2210 (glk_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2243349..2244356
Genome map
AA seq 335 aa AA seqDB search
MSIVVGDIGGTKTLLAVARPEAGGWHFEHRARLPSQDHPSLEHLLEHWLATKGDREEPIS
AVGLALAGPVQGENDSATARLTNLDWPPLDARGLARRFGAPVRLLNDFAAIGAGLDALRP
ADLDTLQAGHHDPAGLRLVVGAGTGLGTCLVGPPPQNRLFPGEGGHADFSPADAWQAALG
EWVRRRLGRCTREHLLSGAGIARITAFVHEQTPAPELADALAAPDPAAAIGTLADSGNPA
ALQVVERFVSIYAGQVGDLALTALPRGGVFIAGGIAPRWKAHFEAPGFLQAFRNKPPMQD
LAAGLPLHLIVHPEPGLLGAAAAAHRAMEPPGDTA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcgtggtcggtgacatcgggggcaccaagacgctgctcgcggtcgcacgcccg
gaggccggcggctggcatttcgaacaccgcgcccggctgcccagccaggaccatcccagc
ctcgagcatctgctggagcactggcttgcaaccaagggcgatcgggaggaaccgatctcc
gcggtcggactggctctggcaggtcccgtccagggcgaaaacgactcggcgacggcgcgc
ctgaccaacctggactggccgcccctcgatgcgcgtggactcgcacgtcggttcggggcg
ccggtacgtctgctcaatgacttcgcggcgatcggcgcaggcctggatgcgctgcgcccg
gcagatctcgacaccctgcaggccggtcatcacgaccctgccggcctccggctggtggtc
ggtgcagggaccgggctgggcacctgcctggtgggaccaccgccgcagaaccgccttttc
cccggggaaggcggacacgcagacttctcgcccgccgacgcctggcaggccgcgctcgga
gaatgggtgcgccgacgcctcggacgctgcacccgggagcacctgctgagcggagccggc
atcgcccggatcaccgccttcgtgcatgaacagacgccggcgccggagctggcagatgcg
ctggcggcaccggatccggcggccgcgatcggcaccctggccgacagcggcaacccggcg
gccttgcaggtcgtcgaacgctttgtcagcatctatgcgggtcaggtcggtgaccttgcg
ctgaccgccttgcctcgcggcggtgtattcatcgccggcgggatcgctccccggtggaag
gcgcatttcgaggcaccgggattccttcaagcgttccgcaacaaaccaccgatgcaggat
ctggcggctggtctgcccctgcacctgatcgtccatcctgaacccggcctgctgggcgcg
gcggcggccgcgcaccgggccatggaacctcctggagatactgcatga

DBGET integrated database retrieval system