KEGG   Thioalkalivibrio nitratireducens: TVNIR_2210Help
Entry
TVNIR_2210        CDS       T02408                                 

Gene name
glk_[H]
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00010  Glycolysis / Gluconeogenesis
tni00052  Galactose metabolism
tni00500  Starch and sucrose metabolism
tni00520  Amino sugar and nucleotide sugar metabolism
tni00521  Streptomycin biosynthesis
tni01100  Metabolic pathways
tni01110  Biosynthesis of secondary metabolites
tni01120  Microbial metabolism in diverse environments
tni01130  Biosynthesis of antibiotics
tni01200  Carbon metabolism
Module
tni_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVNIR_2210 (glk_[H])
   00052 Galactose metabolism
    TVNIR_2210 (glk_[H])
   00500 Starch and sucrose metabolism
    TVNIR_2210 (glk_[H])
   00520 Amino sugar and nucleotide sugar metabolism
    TVNIR_2210 (glk_[H])
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TVNIR_2210 (glk_[H])
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TVNIR_2210 (glk_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TVNIR_2210 (glk_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AGA33866
UniProt: L0DZS7
Position
2243349..2244356
Genome map
AA seq 335 aa AA seqDB search
MSIVVGDIGGTKTLLAVARPEAGGWHFEHRARLPSQDHPSLEHLLEHWLATKGDREEPIS
AVGLALAGPVQGENDSATARLTNLDWPPLDARGLARRFGAPVRLLNDFAAIGAGLDALRP
ADLDTLQAGHHDPAGLRLVVGAGTGLGTCLVGPPPQNRLFPGEGGHADFSPADAWQAALG
EWVRRRLGRCTREHLLSGAGIARITAFVHEQTPAPELADALAAPDPAAAIGTLADSGNPA
ALQVVERFVSIYAGQVGDLALTALPRGGVFIAGGIAPRWKAHFEAPGFLQAFRNKPPMQD
LAAGLPLHLIVHPEPGLLGAAAAAHRAMEPPGDTA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcgtggtcggtgacatcgggggcaccaagacgctgctcgcggtcgcacgcccg
gaggccggcggctggcatttcgaacaccgcgcccggctgcccagccaggaccatcccagc
ctcgagcatctgctggagcactggcttgcaaccaagggcgatcgggaggaaccgatctcc
gcggtcggactggctctggcaggtcccgtccagggcgaaaacgactcggcgacggcgcgc
ctgaccaacctggactggccgcccctcgatgcgcgtggactcgcacgtcggttcggggcg
ccggtacgtctgctcaatgacttcgcggcgatcggcgcaggcctggatgcgctgcgcccg
gcagatctcgacaccctgcaggccggtcatcacgaccctgccggcctccggctggtggtc
ggtgcagggaccgggctgggcacctgcctggtgggaccaccgccgcagaaccgccttttc
cccggggaaggcggacacgcagacttctcgcccgccgacgcctggcaggccgcgctcgga
gaatgggtgcgccgacgcctcggacgctgcacccgggagcacctgctgagcggagccggc
atcgcccggatcaccgccttcgtgcatgaacagacgccggcgccggagctggcagatgcg
ctggcggcaccggatccggcggccgcgatcggcaccctggccgacagcggcaacccggcg
gccttgcaggtcgtcgaacgctttgtcagcatctatgcgggtcaggtcggtgaccttgcg
ctgaccgccttgcctcgcggcggtgtattcatcgccggcgggatcgctccccggtggaag
gcgcatttcgaggcaccgggattccttcaagcgttccgcaacaaaccaccgatgcaggat
ctggcggctggtctgcccctgcacctgatcgtccatcctgaacccggcctgctgggcgcg
gcggcggccgcgcaccgggccatggaacctcctggagatactgcatga

DBGET integrated database retrieval system