KEGG   Thioalkalivibrio nitratireducens: TVNIR_2240Help
Entry
TVNIR_2240        CDS       T02408                                 

Gene name
glcB_[H]
Definition
Malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tni01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tni00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tni00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2274582..2276774
Genome map
AA seq 730 aa AA seqDB search
MTRYVTHERLQVAAELDRFIADEALPGTGIEPQALWSGVDALVHDLIPRNRNLLERRDML
QKQIDAWHRAHPGPIRDLSAFREFLEEIGYLADAPADVRVSTANVDPEIAVQAGPQLVVP
VSNARYALNAVNARWGSLYDALYGTDAIPDDDGAERRADYNPVRGERVIAYARDLLDRAA
PLKSGSHHDAVGYMVDEGRLIVNLDNDDETALEDPSRFAGYQGEARKPSAVLLNNHGLHL
EIQFDPTHPVGREDAAGIKDILVEAAVTTIMDCEDSVAAVDAEDKTGVYRNWLGLMKGDL
EASFQKGDEVITRRQNPDREYTAPDGGNVSLPGRSLMFVRNVGHLMTTPAMLDSNGGEVF
EGILDGIVTSLLALHDLKRSEGGNSRTGSVYIVKPKMHGPDEVAFTCELFDRVEDLLRLP
RNTLKMGIMDEERRTSVNLKACIAAAAARVVFINTGFLDRTGDEIHTAMEAGPVLRKGDM
KGAKWIAAYERNNVVVGLACGLRGRAQIGKGMWAMPDRMAAMLEQKIGHPKAGANTAWVP
SPTAAVLHALHYHDADVAAIQQEMEANLDPDIERQLLDDLLAVPVVERPEWPDEEIQQEL
DNNCQGILGYVVRWVQQGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGVVDAGRV
HATLERMAAVVDEQNRDDPLYQPMAADFDASIAFRAASDLIFKGREQPSGYTEPLLHHWR
AVQKAERQGA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttacgtgacccatgagcggctgcaggtggccgcggaactggaccgcttcatc
gcagacgaagcccttccgggcaccggcatcgagccccaggccctctggtccggcgtcgat
gcgctggtccacgacctgattccgcgcaaccggaatctcctcgagcgacgcgacatgctg
cagaagcagatcgacgcctggcatcgagcacatcccggtccgatccgcgacctctctgcg
ttccgcgaattcctcgaggagatcggctacctggccgacgcccccgccgatgtccgcgtc
agcaccgccaatgtcgacccggaaatcgcggtccaggccgggccgcaactcgtggtaccg
gtgagcaatgcgcggtacgcgctgaacgccgtcaacgcccgctggggcagcctgtacgac
gccctgtacggcaccgacgcgatacccgacgacgacggcgccgaacgccgtgccgactac
aacccggtacggggcgaaagggtgatcgcttacgcgcgcgacctgctggaccgcgcagcc
ccgctcaagtccggctcacaccacgacgcggttggctacatggtcgacgagggccgactg
atcgtgaacctggacaacgacgacgagaccgcactcgaggatccgtcccggttcgccggc
taccaaggcgaggcccggaaaccctcggccgtgctgctgaacaaccacggcctgcacctc
gagatccagttcgaccccacccacccggtcggacgcgaggacgcagccggcatcaaggac
atcctggtcgaggccgccgtcaccacgatcatggactgcgaggactcggtcgctgccgtc
gacgccgaagacaaaaccggcgtataccgcaactggctgggcctgatgaagggtgatctc
gaggcctcgttccagaagggcgacgaggtaatcacccgccggcagaacccggatcgcgag
tacaccgccccggacggcggcaacgtgtccctgcccggccgctcgctgatgttcgtgcgc
aatgtcggccacctgatgaccacccccgcgatgctcgacagcaatggcggcgaggtattc
gaaggcatcctggacggcatcgtgaccagcctgctcgcgctgcacgacctgaagcggtcc
gaaggtggcaactcgcgcaccggctcggtgtacatcgtgaagccgaagatgcacggtccg
gacgaggtcgcgttcacctgcgaactcttcgaccgggtcgaggatctgctgcgccttccg
cgcaacacgctgaagatgggcatcatggacgaagaacggcgcacctcggtgaacctgaag
gcctgtatcgccgctgcggccgcgcgcgtggtgttcatcaacaccggtttcctcgaccgc
accggtgacgagatccacaccgcgatggaggccggtcccgtgctgcgcaaaggcgacatg
aagggcgcgaagtggatcgccgcctacgagcgcaacaatgtcgtcgtcgggctcgcctgc
ggcctgcgcggccgtgcccagatcggcaagggcatgtgggcgatgccggacaggatggcg
gcgatgctcgagcagaaaatcggccacccgaaggccggcgccaacaccgcctgggtgccc
tcgccaaccgccgcggtgctgcatgcgctgcactaccacgacgccgatgtcgccgcgatc
cagcaggagatggaggcgaacctcgacccggacatcgagcggcagctgctcgacgacctg
ctcgcggtgccggtggtcgaacgccccgagtggcccgacgaggagatccagcaggaactc
gacaacaactgccagggcatcctcggctacgtggtccgttgggtgcagcaggggatcggc
tgctcgaaggtcccggacatccacgacgtcggcctgatggaggaccgcgcaacgctgcgc
atctcgagccagcacatcgccaactggctgcaccacggcgtggtcgacgccggccgggtg
catgcgacgttggagcgcatggcggccgtggtcgacgagcagaaccgggacgacccgctg
tatcagccgatggccgccgacttcgacgcgtcgatcgcgttccgcgccgcctccgatctg
atcttcaagggccgcgagcagccctcgggctacaccgagccgctgctgcatcactggcgc
gcggtgcagaaggccgagcggcagggggcctga

DBGET integrated database retrieval system