KEGG   Thioalkalivibrio nitratireducens: TVNIR_2240Help
Entry
TVNIR_2240        CDS       T02408                                 

Gene name
glcB_[H]
Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00620  Pyruvate metabolism
tni00630  Glyoxylate and dicarboxylate metabolism
tni01100  Metabolic pathways
tni01110  Biosynthesis of secondary metabolites
tni01120  Microbial metabolism in diverse environments
tni01200  Carbon metabolism
Module
tni_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TVNIR_2240 (glcB_[H])
   00630 Glyoxylate and dicarboxylate metabolism
    TVNIR_2240 (glcB_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TVNIR_2240 (glcB_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF826
Motif
Other DBs
NCBI-ProteinID: AGA33896
UniProt: L0DZW2
Position
2274582..2276774
Genome map
AA seq 730 aa AA seqDB search
MTRYVTHERLQVAAELDRFIADEALPGTGIEPQALWSGVDALVHDLIPRNRNLLERRDML
QKQIDAWHRAHPGPIRDLSAFREFLEEIGYLADAPADVRVSTANVDPEIAVQAGPQLVVP
VSNARYALNAVNARWGSLYDALYGTDAIPDDDGAERRADYNPVRGERVIAYARDLLDRAA
PLKSGSHHDAVGYMVDEGRLIVNLDNDDETALEDPSRFAGYQGEARKPSAVLLNNHGLHL
EIQFDPTHPVGREDAAGIKDILVEAAVTTIMDCEDSVAAVDAEDKTGVYRNWLGLMKGDL
EASFQKGDEVITRRQNPDREYTAPDGGNVSLPGRSLMFVRNVGHLMTTPAMLDSNGGEVF
EGILDGIVTSLLALHDLKRSEGGNSRTGSVYIVKPKMHGPDEVAFTCELFDRVEDLLRLP
RNTLKMGIMDEERRTSVNLKACIAAAAARVVFINTGFLDRTGDEIHTAMEAGPVLRKGDM
KGAKWIAAYERNNVVVGLACGLRGRAQIGKGMWAMPDRMAAMLEQKIGHPKAGANTAWVP
SPTAAVLHALHYHDADVAAIQQEMEANLDPDIERQLLDDLLAVPVVERPEWPDEEIQQEL
DNNCQGILGYVVRWVQQGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGVVDAGRV
HATLERMAAVVDEQNRDDPLYQPMAADFDASIAFRAASDLIFKGREQPSGYTEPLLHHWR
AVQKAERQGA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttacgtgacccatgagcggctgcaggtggccgcggaactggaccgcttcatc
gcagacgaagcccttccgggcaccggcatcgagccccaggccctctggtccggcgtcgat
gcgctggtccacgacctgattccgcgcaaccggaatctcctcgagcgacgcgacatgctg
cagaagcagatcgacgcctggcatcgagcacatcccggtccgatccgcgacctctctgcg
ttccgcgaattcctcgaggagatcggctacctggccgacgcccccgccgatgtccgcgtc
agcaccgccaatgtcgacccggaaatcgcggtccaggccgggccgcaactcgtggtaccg
gtgagcaatgcgcggtacgcgctgaacgccgtcaacgcccgctggggcagcctgtacgac
gccctgtacggcaccgacgcgatacccgacgacgacggcgccgaacgccgtgccgactac
aacccggtacggggcgaaagggtgatcgcttacgcgcgcgacctgctggaccgcgcagcc
ccgctcaagtccggctcacaccacgacgcggttggctacatggtcgacgagggccgactg
atcgtgaacctggacaacgacgacgagaccgcactcgaggatccgtcccggttcgccggc
taccaaggcgaggcccggaaaccctcggccgtgctgctgaacaaccacggcctgcacctc
gagatccagttcgaccccacccacccggtcggacgcgaggacgcagccggcatcaaggac
atcctggtcgaggccgccgtcaccacgatcatggactgcgaggactcggtcgctgccgtc
gacgccgaagacaaaaccggcgtataccgcaactggctgggcctgatgaagggtgatctc
gaggcctcgttccagaagggcgacgaggtaatcacccgccggcagaacccggatcgcgag
tacaccgccccggacggcggcaacgtgtccctgcccggccgctcgctgatgttcgtgcgc
aatgtcggccacctgatgaccacccccgcgatgctcgacagcaatggcggcgaggtattc
gaaggcatcctggacggcatcgtgaccagcctgctcgcgctgcacgacctgaagcggtcc
gaaggtggcaactcgcgcaccggctcggtgtacatcgtgaagccgaagatgcacggtccg
gacgaggtcgcgttcacctgcgaactcttcgaccgggtcgaggatctgctgcgccttccg
cgcaacacgctgaagatgggcatcatggacgaagaacggcgcacctcggtgaacctgaag
gcctgtatcgccgctgcggccgcgcgcgtggtgttcatcaacaccggtttcctcgaccgc
accggtgacgagatccacaccgcgatggaggccggtcccgtgctgcgcaaaggcgacatg
aagggcgcgaagtggatcgccgcctacgagcgcaacaatgtcgtcgtcgggctcgcctgc
ggcctgcgcggccgtgcccagatcggcaagggcatgtgggcgatgccggacaggatggcg
gcgatgctcgagcagaaaatcggccacccgaaggccggcgccaacaccgcctgggtgccc
tcgccaaccgccgcggtgctgcatgcgctgcactaccacgacgccgatgtcgccgcgatc
cagcaggagatggaggcgaacctcgacccggacatcgagcggcagctgctcgacgacctg
ctcgcggtgccggtggtcgaacgccccgagtggcccgacgaggagatccagcaggaactc
gacaacaactgccagggcatcctcggctacgtggtccgttgggtgcagcaggggatcggc
tgctcgaaggtcccggacatccacgacgtcggcctgatggaggaccgcgcaacgctgcgc
atctcgagccagcacatcgccaactggctgcaccacggcgtggtcgacgccggccgggtg
catgcgacgttggagcgcatggcggccgtggtcgacgagcagaaccgggacgacccgctg
tatcagccgatggccgccgacttcgacgcgtcgatcgcgttccgcgccgcctccgatctg
atcttcaagggccgcgagcagccctcgggctacaccgagccgctgctgcatcactggcgc
gcggtgcagaaggccgagcggcagggggcctga

DBGET integrated database retrieval system