KEGG   Thioalkalivibrio nitratireducens: TVNIR_2240Help
Entry
TVNIR_2240        CDS       T02408                                 

Gene name
glcB_[H]
Definition
(RefSeq) Malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVNIR_2240 (glcB_[H])
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TVNIR_2240 (glcB_[H])
   00630 Glyoxylate and dicarboxylate metabolism
    TVNIR_2240 (glcB_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TVNIR_2240 (glcB_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2274582..2276774
Genome map
AA seq 730 aa AA seqDB search
MTRYVTHERLQVAAELDRFIADEALPGTGIEPQALWSGVDALVHDLIPRNRNLLERRDML
QKQIDAWHRAHPGPIRDLSAFREFLEEIGYLADAPADVRVSTANVDPEIAVQAGPQLVVP
VSNARYALNAVNARWGSLYDALYGTDAIPDDDGAERRADYNPVRGERVIAYARDLLDRAA
PLKSGSHHDAVGYMVDEGRLIVNLDNDDETALEDPSRFAGYQGEARKPSAVLLNNHGLHL
EIQFDPTHPVGREDAAGIKDILVEAAVTTIMDCEDSVAAVDAEDKTGVYRNWLGLMKGDL
EASFQKGDEVITRRQNPDREYTAPDGGNVSLPGRSLMFVRNVGHLMTTPAMLDSNGGEVF
EGILDGIVTSLLALHDLKRSEGGNSRTGSVYIVKPKMHGPDEVAFTCELFDRVEDLLRLP
RNTLKMGIMDEERRTSVNLKACIAAAAARVVFINTGFLDRTGDEIHTAMEAGPVLRKGDM
KGAKWIAAYERNNVVVGLACGLRGRAQIGKGMWAMPDRMAAMLEQKIGHPKAGANTAWVP
SPTAAVLHALHYHDADVAAIQQEMEANLDPDIERQLLDDLLAVPVVERPEWPDEEIQQEL
DNNCQGILGYVVRWVQQGIGCSKVPDIHDVGLMEDRATLRISSQHIANWLHHGVVDAGRV
HATLERMAAVVDEQNRDDPLYQPMAADFDASIAFRAASDLIFKGREQPSGYTEPLLHHWR
AVQKAERQGA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttacgtgacccatgagcggctgcaggtggccgcggaactggaccgcttcatc
gcagacgaagcccttccgggcaccggcatcgagccccaggccctctggtccggcgtcgat
gcgctggtccacgacctgattccgcgcaaccggaatctcctcgagcgacgcgacatgctg
cagaagcagatcgacgcctggcatcgagcacatcccggtccgatccgcgacctctctgcg
ttccgcgaattcctcgaggagatcggctacctggccgacgcccccgccgatgtccgcgtc
agcaccgccaatgtcgacccggaaatcgcggtccaggccgggccgcaactcgtggtaccg
gtgagcaatgcgcggtacgcgctgaacgccgtcaacgcccgctggggcagcctgtacgac
gccctgtacggcaccgacgcgatacccgacgacgacggcgccgaacgccgtgccgactac
aacccggtacggggcgaaagggtgatcgcttacgcgcgcgacctgctggaccgcgcagcc
ccgctcaagtccggctcacaccacgacgcggttggctacatggtcgacgagggccgactg
atcgtgaacctggacaacgacgacgagaccgcactcgaggatccgtcccggttcgccggc
taccaaggcgaggcccggaaaccctcggccgtgctgctgaacaaccacggcctgcacctc
gagatccagttcgaccccacccacccggtcggacgcgaggacgcagccggcatcaaggac
atcctggtcgaggccgccgtcaccacgatcatggactgcgaggactcggtcgctgccgtc
gacgccgaagacaaaaccggcgtataccgcaactggctgggcctgatgaagggtgatctc
gaggcctcgttccagaagggcgacgaggtaatcacccgccggcagaacccggatcgcgag
tacaccgccccggacggcggcaacgtgtccctgcccggccgctcgctgatgttcgtgcgc
aatgtcggccacctgatgaccacccccgcgatgctcgacagcaatggcggcgaggtattc
gaaggcatcctggacggcatcgtgaccagcctgctcgcgctgcacgacctgaagcggtcc
gaaggtggcaactcgcgcaccggctcggtgtacatcgtgaagccgaagatgcacggtccg
gacgaggtcgcgttcacctgcgaactcttcgaccgggtcgaggatctgctgcgccttccg
cgcaacacgctgaagatgggcatcatggacgaagaacggcgcacctcggtgaacctgaag
gcctgtatcgccgctgcggccgcgcgcgtggtgttcatcaacaccggtttcctcgaccgc
accggtgacgagatccacaccgcgatggaggccggtcccgtgctgcgcaaaggcgacatg
aagggcgcgaagtggatcgccgcctacgagcgcaacaatgtcgtcgtcgggctcgcctgc
ggcctgcgcggccgtgcccagatcggcaagggcatgtgggcgatgccggacaggatggcg
gcgatgctcgagcagaaaatcggccacccgaaggccggcgccaacaccgcctgggtgccc
tcgccaaccgccgcggtgctgcatgcgctgcactaccacgacgccgatgtcgccgcgatc
cagcaggagatggaggcgaacctcgacccggacatcgagcggcagctgctcgacgacctg
ctcgcggtgccggtggtcgaacgccccgagtggcccgacgaggagatccagcaggaactc
gacaacaactgccagggcatcctcggctacgtggtccgttgggtgcagcaggggatcggc
tgctcgaaggtcccggacatccacgacgtcggcctgatggaggaccgcgcaacgctgcgc
atctcgagccagcacatcgccaactggctgcaccacggcgtggtcgacgccggccgggtg
catgcgacgttggagcgcatggcggccgtggtcgacgagcagaaccgggacgacccgctg
tatcagccgatggccgccgacttcgacgcgtcgatcgcgttccgcgccgcctccgatctg
atcttcaagggccgcgagcagccctcgggctacaccgagccgctgctgcatcactggcgc
gcggtgcagaaggccgagcggcagggggcctga

DBGET integrated database retrieval system