KEGG   Thioalkalivibrio nitratireducens: TVNIR_2247Help
Entry
TVNIR_2247        CDS       T02408                                 

Gene name
aceA_[H]
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00630  Glyoxylate and dicarboxylate metabolism
tni01100  Metabolic pathways
tni01110  Biosynthesis of secondary metabolites
tni01120  Microbial metabolism in diverse environments
tni01200  Carbon metabolism
Module
tni_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TVNIR_2247 (aceA_[H])
Enzymes [BR:tni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TVNIR_2247 (aceA_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AGA33903
UniProt: L0DXZ9
Position
complement(2282579..2283901)
Genome map
AA seq 440 aa AA seqDB search
MTQSDTPSREQQIRALEREWAENPRWQGVRRGYSAADVVRLRGSVRPEHSYARMGAERLW
KILHGGARKGYVNALGTLTGGQALQQARAGVEAIYLSGWQVAADGNTSETMYPDQSLYAY
DSVPAMVRRINNAFQRGDEIQWSRGIGPGDDGYVDHFLPIVADAEAGFGGVLNAFELMKN
MIVAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAVQKLIAARLAADVTGVPAVLLARTD
AEAANLLTSDVDDNDRPFLTGERTSEGFFRVRNGVEQAISRGVAYAPYADLVWCETGTPD
LGFAREFAQAVRAENPNQLLAYNCSPSFNWKKNLSDAQIASFQDELSTLGYKFQFITLAG
IHSMWFNMFDLAYDYARGEGMRHYVEKVQQPEFAARERGYTFVSHQQEVGAGYFDDVTTV
IQGGGSSVTALKGSTEEDQF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaagcgataccccaagccgcgagcagcagatccgggccctggagcgggaatgg
gcagagaatccccgctggcagggcgtacgccgcggctattcggccgccgacgtggtccga
ctgcgggggtcggtgcgccccgaacacagctacgcgcggatgggggcggaaaggctctgg
aaaatcctgcacggcggggcacgcaagggctacgtgaacgccctcggcacgctgaccggc
ggccaggcgctgcagcaggcgcgtgcgggcgtcgaggcgatctacctgtccggctggcag
gtcgcggccgacggcaacacctcggagacgatgtacccggaccagtcgctgtacgcctac
gactcggtgccggcgatggtgcgccggatcaacaacgcgttccagcgtggcgacgagatc
cagtggtcacgcggtatcggtcccggggacgacggttatgtcgaccacttcctgccgatc
gtcgccgacgccgaggcgggtttcggcggcgtgctgaatgccttcgagctgatgaagaac
atgatcgtcgcaggggccgcgggcgtacatttcgaggaccagcttgcggcggtgaagaaa
tgtggccatatgggcggcaaggtgctggtgccgacgcaggaggcggtgcagaagctgatc
gcggcgcggctcgccgccgacgtgaccggcgtgccggcggttctgctggcgcgcaccgac
gccgaggcggcgaatctgctgaccagcgacgtcgacgacaacgaccggccgttcctgacc
ggcgagcgtacctccgagggcttcttccgagtgcggaatggtgtcgagcaggcgatcagc
cgtggtgtcgcgtatgcaccgtacgccgacctggtctggtgcgagaccggcacgccggat
ctcggcttcgcgcgcgagttcgcgcaggcggtccgggcggagaacccgaaccagctgctg
gcgtacaactgctcgccttcgttcaactggaagaagaacctgagcgacgcgcagatcgcg
agtttccaggacgagttgtccacgcttggctacaagttccagttcatcacgctggccggg
attcacagcatgtggttcaacatgttcgacctcgcctacgactacgcgcgcggggagggt
atgcgccactacgtggagaaggtgcagcagcccgagttcgcggcgcgcgagcgcggctac
accttcgtttcgcaccagcaggaggtcggcgccggttacttcgacgacgtgaccactgtg
atccagggcggcggctcctcggtcaccgcgctgaaaggctcgaccgaggaagatcagttc
tga

DBGET integrated database retrieval system