KEGG   Thioalkalivibrio nitratireducens: TVNIR_2488Help
Entry
TVNIR_2488        CDS       T02408                                 

Gene name
sucC_[H]
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00020  Citrate cycle (TCA cycle)
tni00640  Propanoate metabolism
tni00660  C5-Branched dibasic acid metabolism
tni01100  Metabolic pathways
tni01110  Biosynthesis of secondary metabolites
tni01120  Microbial metabolism in diverse environments
tni01130  Biosynthesis of antibiotics
tni01200  Carbon metabolism
Module
tni_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tni_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TVNIR_2488 (sucC_[H])
   00640 Propanoate metabolism
    TVNIR_2488 (sucC_[H])
   00660 C5-Branched dibasic acid metabolism
    TVNIR_2488 (sucC_[H])
Enzymes [BR:tni01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TVNIR_2488 (sucC_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATPgrasp_Ter Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: AGA34131
UniProt: L0E0G7
Position
complement(2572115..2573275)
Genome map
AA seq 386 aa AA seqDB search
MNLHEFQAKALFRSAGIPVPPGELITGVDDTAGAWARLGADTVWVKAQVHSGGRGKAGGV
VRAADPAEAEAAVARLLGSRLVTGAGGPEGLPIDQVLMEPAAAIEREFYFGMLVDRSRAS
VVMVISAEGGMDIEELARERPVAVVTLPIHPVTGVMPFHGRRAARVLGLRGDPARAAARL
VADAYRLFQSSDAQLLEINPLVLTSDDRLLALDGKLVIDDSATYRQREIFGLRDARQRHE
AEERAHEHDLNYIRLDGTIGCMVNGAGLAMATMDLIQHHGGQPANFLDVGGGTTVERVAA
AFKLILSDTSVRAVLVNIFGGIVRCDLIAEGIIAAVREVHVQVPVVVRLEGTNAEAGREA
LAASGLDIVAAADLDQAARAAVEAAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacctccacgaattccaggcgaaggcgctgttccgttccgccggcatcccggtgccg
ccgggcgaactgatcaccggggtcgacgataccgccggggcatgggcacgcctcggcgcg
gacacggtatgggtcaaggcgcaggtgcacagcggcggacgtggcaaggccggtggcgtt
gtccgggccgccgatccggccgaggccgaagcggcggtggcacgtctgctcgggtcacgg
ctggtcaccggggcgggcggcccggagggactgccgatcgaccaggtgctgatggaaccg
gcagcggcgatcgagcgcgagttctatttcgggatgctggtcgaccggtcccgggcctcg
gtggtgatggtgatctcggccgagggtggcatggacatcgaagaactggcccgggagcgg
cccgttgcggtggttacgctgccgatccatccggtcaccggggtgatgccgtttcatggg
cggcgcgccgcgcgggtgctggggctgcgcggggatcccgcgcgtgctgccgcgcggctc
gtcgccgatgcctaccgtctgttccagtcctccgatgcgcagttgcttgaaatcaacccg
ctggtgctgacttcggacgaccgactgctcgcactggatggcaagctggtgatcgacgat
tccgctacctaccgccagcgcgagatcttcgggctgcgcgacgcgcgccagcgccacgag
gccgaggaacgcgcgcacgagcatgatctcaattacattcgcctcgatggcaccatcggc
tgcatggtgaacggcgcggggctggcaatggcgacgatggacctgatccagcaccatggc
gggcaacccgcgaatttcctcgacgtcggtggcggtaccacggtcgagcgcgtcgctgcg
gcgttcaagctgatcctgtccgatacctccgtgcgcgcggtgctggtgaacatcttcggg
ggcatcgtgcgctgcgatctgatcgccgagggcatcatcgccgcagtgcgggaagtgcac
gtgcaggtgccggtcgttgtccggctggagggcacgaacgcggaagcgggccgcgaggca
ctggccgcgagcggactggatatcgtcgccgccgccgacctggatcaggcggcgcgggcc
gcggtggaggcggcggcatga

DBGET integrated database retrieval system