KEGG   Thioalkalivibrio nitratireducens: TVNIR_2626Help
Entry
TVNIR_2626        CDS       T02408                                 

Gene name
hisD_[H]
Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tni01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tni00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2718678..2719979)
Genome map
AA seq 433 aa AA seqDB search
MPEIQRLDSRETTFWGELDRLLSWESVADHGVRAIVDEILAAVRSEGDAALLRYTARFDR
LSVAQASELEVPATRLRAALDGLPAAQRDALETAAGRIRRYAECQRMQDWQIEDPDGTVL
GQRVTPLDSVGLYVPGGKAAYPSSVLMNAIPAKVAGVGLLVMVVPAPAGELNELVLAAAA
VAGVDRVFTIGGAQAVAALAHGTATIPAVDKIVGPGNIYVAAAKREVFGTVGIDMIAGPS
EILVVCDGQTDPDWIAADLFSQAEHDEQAQAILVSPDSAFLERVAEAMERLLRAMPRAEI
IRTSLGRRGALIRVRDLDEAVRVANHIAPEHLELSVADPQALLDAGLRHAGAVFMGRYTS
EAVGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSIIACSPEGAAALGRTASVLARGEG
LVAHARSAEMRGE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagattcagcgactggacagccgtgagaccacgttctggggcgaactcgaccgc
cttctgtcctgggagtcggtcgccgaccatggcgtgcgcgcgatcgtcgacgagatcctc
gcggccgtgcgcagcgagggggatgcggcgttgctgcgctataccgcacgcttcgaccgg
ctgtcggtggcgcaggcgtcggaactggaggttccggcaacacgcctgcgggcggcgctg
gatggccttccggcggcgcagcgcgacgcgttggagactgccgcggggcgcatccgccgc
tacgccgaatgccagcggatgcaggactggcagatcgaggatccggacggcaccgtgctc
ggccagcgcgtgacgccgctggactcggtgggtctgtacgtgcccgggggcaaggccgcc
tacccgtcgtcggtgctgatgaacgcgattcccgccaaggtcgccggcgtcgggctcctg
gtgatggtcgtgcccgccccggccggcgagctgaacgagctggtgctggccgccgctgcg
gtggccggcgtcgaccgggtgttcacgatcggcggtgcgcaggccgttgcggcgctggcc
catggtaccgcgacgatccccgcggtcgacaagatcgttggtccgggcaatatctacgtg
gcggcggccaagcgcgaggtcttcggcaccgtcggcatcgacatgatcgccgggccgtcc
gagatcctggtggtctgcgacggtcagaccgatccggactggatcgcggccgatctgttc
tcgcaggcggagcacgacgagcaggcgcaggcgatcctggtctcgccggattccgcgttc
ctggagcgggtggcggaggcgatggagcgcctgctacgggcgatgccccgggcggagatc
atccgcaccagcctgggccggcgcggggcgctgatccgcgtgcgcgatctggacgaggcg
gttcgcgtcgccaaccacattgccccggagcacctggagctgtcggtagccgacccgcag
gcgctgctcgacgccggcctgcggcacgcgggggccgtcttcatgggccgttatacttcc
gaggcggtgggggactactgtgccgggcccaaccatgtgctgcccacttcgcgtaccgcg
cgcttctcgtcgccgctgggcgtctatgacttccagaagcgctccagcatcatcgcctgt
tcgcccgagggcgcggccgcgctcgggcgtaccgcctcggtgctggcgcgcggggaaggg
ctggtggctcatgcgcgctctgcggagatgcgcggtgagtag

DBGET integrated database retrieval system