KEGG   Thioalkalivibrio nitratireducens: TVNIR_2741Help
Entry
TVNIR_2741        CDS       T02408                                 

Gene name
mauG_[H]
Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tni  Thioalkalivibrio nitratireducens
Brite
Enzymes [BR:tni01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     TVNIR_2741 (mauG_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2826071..2827222
Genome map
AA seq 383 aa AA seqDB search
MAATGLALLLLLPGCGSETFVDDHGARLSAFEYDVPERIPLPVEPEGNPMTEEKFQLGRH
LFFDTRLSANGTIACASCHHQDKAFADGRALPVGATGEVHPRNSQGLVNAAYFPSLTWAN
PVLLTIEQQIMIPLFGEEPVEHGINDSNRDQILYELETDPVYQRLFADAFPDDDQPFTFH
RVVQALASFVRGITAFSSRFDRYQEGDRDALTASERQGMELFFSERMECFHCHGGYNFTN
SVYDRSHFFREMPFHNTGLFNIDGLGGYPEPNTGVHEITGRPGDMGRFRAPSLRNVALTA
PYMHDGSIETLEEVIQTYAAGGRNVTTGPHVGDGRMNPLKDGFVVGFQLSDAELQAVLDF
LHALTDESVTTNPRFSNPWEEQE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgaccggactggcgcttctcttgctgttgcccggctgcggcagcgagaccttc
gtcgacgaccacggcgcccgactcagcgccttcgagtacgacgtgcccgaacggattccg
ctgcccgtcgaacccgagggcaatccgatgaccgaggagaagttccagctcggccggcac
ctgttcttcgacacgcgcctttcggccaatgggacgatcgcctgcgcgtcgtgccaccac
caggacaaggccttcgcggacggtcgcgccctgccggtcggcgcgaccggcgaagtgcac
ccccgcaattcgcaggggctggtcaacgccgcctacttcccatcgctgacctgggccaac
ccggtcctgctgaccatcgagcagcagatcatgatcccactcttcggcgaggaaccggtc
gaacacggcatcaacgacagcaaccgggatcagatcctgtacgaactggagaccgatccg
gtctaccagcgcctgttcgccgacgcgtttcccgacgacgaccagcccttcaccttccac
cgggtggtgcaggcactggccagcttcgtacgcggcatcacggcgttcagttcccgcttc
gaccgctaccaggaaggcgaccgcgacgctctgaccgccagcgagcgacagggcatggaa
ctgtttttcagcgagcggatggaatgcttccattgccacggcgggtacaacttcacgaat
tcggtctacgaccgcagccatttcttccgcgagatgccgttccacaacaccggcctgttc
aacatcgacgggctgggcggctacccggaacccaacaccggtgttcacgagatcaccggg
cggccgggcgacatgggccggtttcgggcccccagcctgcgcaacgtggcactgaccgca
ccctacatgcacgacgggtccatcgaaaccctggaagaggtgatccagacctacgccgcg
ggcggtcgcaatgtcaccaccggcccgcatgtcggcgatggccggatgaacccgttgaag
gacggtttcgtggtcggcttccagctctcggacgccgaactccaggcggtgctcgatttc
ctgcacgcgttgaccgacgaatccgtaaccaccaatccacgcttcagcaacccctgggaa
gaacaggaatga

DBGET integrated database retrieval system