KEGG   Thioalkalivibrio nitratireducens: TVNIR_2786Help
Entry
TVNIR_2786        CDS       T02408                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tni  Thioalkalivibrio nitratireducens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2876041..2876748)
Genome map
AA seq 235 aa AA seqDB search
MLRPRRLLIPLLTLLIAAPAAASDAIEQRLAEVVPTDAPDAIEPTAIPGVFEVRYGADVF
YVSEDGRYLIQGSLIDLETRRNLTEETREQARAAMFSEIPDSELTVYVPEREVRYVMNVF
TDPNCPYCRRQHQEMQTYLDAGVKVRYFMYPVLGRESPDVMRNIWCSDDRNAAMDLAKEG
KPVPEAHCDTPADEHLALGRELGISGTPATITSGGHQISGYRPAIEIIQTLNSAR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctacgaccccgcagactcctgattccgctgttgaccctgctgatcgcggccccggcc
gccgccagcgacgcgatcgagcagcgcctggccgaggtggtgccgacggacgcgcccgac
gcgatcgagcccaccgccatcccgggcgtgttcgaggtgcgctacggggcagacgtgttc
tacgtatccgaggatggccggtacctgatccagggcagcctgatcgatctggagacccgg
aggaatctgaccgaggagacgcgcgagcaggcccgtgccgccatgttctcggagatccct
gattccgaactcaccgtctacgttcccgagcgggaagtgcggtacgtgatgaacgtgttc
acggaccccaactgcccgtactgccggcgccagcaccaggagatgcagacttacctggat
gccggggtgaaggtccgctacttcatgtacccggtgctggggcgggaatcccccgacgtg
atgcgcaatatctggtgttcggacgaccgcaacgccgcgatggatctcgcgaaggaaggc
aagccggtccccgaggcacactgcgacacgccggccgacgagcatttggccctagggcgg
gaactggggatcagcggaaccccggcaaccatcaccagcggcggccaccagatctccggg
tatcggccggcgatcgagatcatccagacgctgaacagcgcgcggtaa

DBGET integrated database retrieval system