KEGG   Thioalkalivibrio nitratireducens: TVNIR_2819Help
Entry
TVNIR_2819        CDS       T02408                                 

Gene name
yliJ_[H]
Definition
Glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TVNIR_2819 (yliJ_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TVNIR_2819 (yliJ_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2910407..2911099
Genome map
AA seq 230 aa AA seqDB search
MALPHLHLISFPLCPFVQRSVITLKHKNIPFERTYLDPTALPDWFLEKSPTGKVPLLIVD
ERTALFESAAINEYLDEISPPRLLPEDPLERAQARAWIALASEMIAAQFRWMGAPTEEAF
GEARDEAAKGLRQFEKQCRAGPCFTGPDFSLLDATVAPVLMRYELLQDPGSPWQPAEFPN
LARWWQHISEMPAVRESVPDDFLARLPRFLTNQQGFAGPRLAAGLAERGH
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccccatctgcatctgatcagctttccgttatgtccgttcgtgcagcgtagc
gtcatcacgctgaaacacaagaacatcccgttcgaacggacctacctcgatcccaccgca
ctgccggattggttcctggagaaatcccctaccggcaaggtgccgctgctgatcgtagac
gaacgcaccgcgctgttcgaatcagcggcgatcaacgagtacctggacgagatctccccg
ccccggctgctgccggaagacccgctggaacgggcccaggcccgagcctggatcgctctc
gcatcggagatgatcgcggcccagttccgctggatgggcgcccccaccgaggaggccttc
ggcgaggcccgcgacgaggccgcgaagggtttgcgccagttcgagaaacagtgcagggcc
ggcccctgcttcaccgggcccgatttctcgctgctcgacgcgaccgtggcaccggtgctg
atgcgctacgaactgctgcaggatcccggcagtccctggcagccagccgagttcccgaac
cttgcgcgctggtggcagcacatctcggaaatgcccgcggtgcgcgagtccgtgcccgac
gatttcctggcacgcctgccgcgcttcctgaccaatcagcagggctttgccggaccacgc
ctggccgccggtctcgcggaacggggccactga

DBGET integrated database retrieval system