KEGG   Thioalkalivibrio nitratireducens: TVNIR_2951Help
Entry
TVNIR_2951        CDS       T02408                                 

Gene name
thrC_[H]
Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVNIR_2951 (thrC_[H])
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVNIR_2951 (thrC_[H])
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TVNIR_2951 (thrC_[H])
Enzymes [BR:tni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TVNIR_2951 (thrC_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3044893..3046035)
Genome map
AA seq 380 aa AA seqDB search
MAFGHRYTGLIERYRDRLPVHDDTRIISLGEGNTPLIRLNNVPRHIGRDVELYVKFEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSASAAAYAARAGITAFVVIPDGKIAMG
KLAQAMMHGSVVIQIEGNFDDGMRLVKQVAESAPATLVNSVNPFRLQGQKTAAFEIVEEL
GRAPDYHCLPVGNAGNITAHWIGYCELSASSGEHVTEACTFCKGHCRFAGGGVAGQRPTM
VGYQASGSAPFLRGAMVDNPETVATAIRIGHPQSWNVAWKVQQESGGWFDECTDQEILAA
QKLLTEKEGVFCEPASAASVAGALRDIRTGRIPEGSSVVCTLTGHGLKDPDTAISQAGSA
PLKVAAELDAVTRTILDNMG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctttcggacaccgctataccggcctgatcgagcgttaccgcgaccgcctgccggtg
cacgacgacacccggatcatctcgctgggcgagggcaatacaccgctgatccggttgaac
aatgtcccgcgtcacatcggccgggatgtggaactctacgtgaagttcgagggcctgaac
ccgaccggctcgttcaaggaccgcggcatgaccatggcggtgaccaaggcggtggaggag
ggctcgaaagcgatcatttgcgcgtcgaccggcaacacctcggcgtccgcggcggcctac
gcggcgcgagcggggatcaccgcgttcgtggtgatccccgacggcaagatcgcgatgggc
aagctggcgcaggcgatgatgcacggatcggtggtgatccagatcgagggcaacttcgac
gacggcatgcgcctggtgaagcaggtcgccgagtccgccccggccacgctggtgaactcg
gtgaatccgttccggctccaggggcagaagaccgcggccttcgagatcgtggaggaactg
ggccgcgccccggattaccactgtctgccggtcggcaatgcaggcaatatcaccgcgcac
tggatcggctattgcgagctgtcggccagttcgggcgagcacgtgaccgaggcctgtacc
ttctgcaaggggcactgccgtttcgccggcggtggcgtcgccgggcagcgtccgacgatg
gttggctaccaggcgagcggcagcgcacccttcctgcgcggggcgatggtcgataatccc
gagacggtcgcgaccgcgatccggatcgggcacccgcagtcctggaacgtcgcctggaag
gtgcaacaggaatcgggcgggtggttcgacgaatgcaccgaccaagagatcctggcggcg
cagaagttgctgacggagaaggagggcgtgttctgcgagcccgcgtctgcagcctcggtt
gccggtgcgttgcgcgacatccggacgggccgcattcccgagggatccagtgtcgtctgc
acgctgaccggacacggcctgaaggatcccgataccgcgatctcccaggccggttccgcg
ccgctgaaggttgcggcggaactggatgcggtgacccggacgattctggacaacatgggc
tga

DBGET integrated database retrieval system