KEGG   Thioalkalivibrio nitratireducens: TVNIR_2951Help
Entry
TVNIR_2951        CDS       T02408                                 

Gene name
thrC_[H]
Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVNIR_2951 (thrC_[H])
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TVNIR_2951 (thrC_[H])
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TVNIR_2951 (thrC_[H])
Enzymes [BR:tni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TVNIR_2951 (thrC_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3044893..3046035)
Genome map
AA seq 380 aa AA seqDB search
MAFGHRYTGLIERYRDRLPVHDDTRIISLGEGNTPLIRLNNVPRHIGRDVELYVKFEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSASAAAYAARAGITAFVVIPDGKIAMG
KLAQAMMHGSVVIQIEGNFDDGMRLVKQVAESAPATLVNSVNPFRLQGQKTAAFEIVEEL
GRAPDYHCLPVGNAGNITAHWIGYCELSASSGEHVTEACTFCKGHCRFAGGGVAGQRPTM
VGYQASGSAPFLRGAMVDNPETVATAIRIGHPQSWNVAWKVQQESGGWFDECTDQEILAA
QKLLTEKEGVFCEPASAASVAGALRDIRTGRIPEGSSVVCTLTGHGLKDPDTAISQAGSA
PLKVAAELDAVTRTILDNMG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctttcggacaccgctataccggcctgatcgagcgttaccgcgaccgcctgccggtg
cacgacgacacccggatcatctcgctgggcgagggcaatacaccgctgatccggttgaac
aatgtcccgcgtcacatcggccgggatgtggaactctacgtgaagttcgagggcctgaac
ccgaccggctcgttcaaggaccgcggcatgaccatggcggtgaccaaggcggtggaggag
ggctcgaaagcgatcatttgcgcgtcgaccggcaacacctcggcgtccgcggcggcctac
gcggcgcgagcggggatcaccgcgttcgtggtgatccccgacggcaagatcgcgatgggc
aagctggcgcaggcgatgatgcacggatcggtggtgatccagatcgagggcaacttcgac
gacggcatgcgcctggtgaagcaggtcgccgagtccgccccggccacgctggtgaactcg
gtgaatccgttccggctccaggggcagaagaccgcggccttcgagatcgtggaggaactg
ggccgcgccccggattaccactgtctgccggtcggcaatgcaggcaatatcaccgcgcac
tggatcggctattgcgagctgtcggccagttcgggcgagcacgtgaccgaggcctgtacc
ttctgcaaggggcactgccgtttcgccggcggtggcgtcgccgggcagcgtccgacgatg
gttggctaccaggcgagcggcagcgcacccttcctgcgcggggcgatggtcgataatccc
gagacggtcgcgaccgcgatccggatcgggcacccgcagtcctggaacgtcgcctggaag
gtgcaacaggaatcgggcgggtggttcgacgaatgcaccgaccaagagatcctggcggcg
cagaagttgctgacggagaaggagggcgtgttctgcgagcccgcgtctgcagcctcggtt
gccggtgcgttgcgcgacatccggacgggccgcattcccgagggatccagtgtcgtctgc
acgctgaccggacacggcctgaaggatcccgataccgcgatctcccaggccggttccgcg
ccgctgaaggttgcggcggaactggatgcggtgacccggacgattctggacaacatgggc
tga

DBGET integrated database retrieval system