KEGG   Thioalkalivibrio nitratireducens: TVNIR_2958Help
Entry
TVNIR_2958        CDS       T02408                                 

Definition
Protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tni  Thioalkalivibrio nitratireducens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3051676..3052341)
Genome map
AA seq 221 aa AA seqDB search
MGLDVAGAGLTSQRARDRLIAQLSQLGIRDPAVLEAVRAVPRHLFVEEALVHRAYENIAL
PIGYRQTVSQPYIVARMTEALLEYGPLRTVLEVGTGSGYQAAVLAQLCERVYSVERILAL
SRSARELLSRLKINNVSLRHGDGGEGWPARGPFDGILLTAAPRDIPHELLTQLAPGGRLV
APVEGPDGRQQLVRYTHTEEAYVRDLLDTVCFVPMLSGAES
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcttgatgtcgccggcgcgggtctgacctcgcagcgtgcgcgcgatcgcctgatc
gcacaactctcgcaactgggaatccgtgatccggcagtgctcgaggccgttcgcgccgta
ccgcggcacctgttcgtcgaggaggcgctggtgcatcgagcctacgagaacatcgcgctg
ccgatcgggtaccggcagaccgtttcccagccctacatcgttgcccggatgaccgaggcc
ctgctcgaatacggccccctgcgtaccgtgctcgaggtcggaaccggctctggctaccag
gctgcggtgctggcgcaactttgcgagcgcgtgtattcggtggaacggatcctggccttg
agccgcagcgcgcgggaactgctcagccggttgaagatcaacaatgtcagcctgcgtcat
ggcgacggtggtgaaggctggccggcccgggggccattcgacggtatcctgctcacggct
gccccgcgtgatatccctcacgagttgctgacccagctggcgcccggagggcggctggtg
gcaccggtcgaggggccggacgggcgccagcagctggtgcgctacacgcataccgaggag
gcctatgtacgcgacctgctcgacacggtctgtttcgtaccgatgctgtcgggtgccgag
tcatga

DBGET integrated database retrieval system