KEGG   Thioalkalivibrio nitratireducens: TVNIR_3162Help
Entry
TVNIR_3162        CDS       T02408                                 

Gene name
ccp_[H]
Definition
Cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tni  Thioalkalivibrio nitratireducens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3271364..3272365
Genome map
AA seq 333 aa AA seqDB search
MNSLRKSTRAAVTALGVGITLACTGIAVADDGYGDYRNRFDPLPAMPPIPADSSLTPERV
ELGNMLFFEPRISSSGVISCATCHNPALGWSDRIPRAVGHEGQVGERNTPTVLNSGFFEA
QFWDGRAADLEEQALGPIEADIEMAMSLDEAIARLNEFDIYKKKFAAAFPGDENPIREEN
VAKALASFQRTLNTPNSRFDRYLNGDLDALTEQEKRGMKKFADSGCQACHSGPAFTDSRF
HRIQVPGSEDEGRFLVTGKDSDRFAFKTPTLRNIALTYPYMNNGATATLEEAVAIMGQEM
LGREYAEDEIGDLVAFLHTLTGEMPTFEIPALP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccttcgtaagtccacccgggcggccgtaacggcactgggagtgggaatcacc
ctcgcctgtaccgggattgccgtagccgacgacggctacggcgactaccgcaaccggttc
gaccccctgccggcgatgccgccgattccagccgacagctcgctgaccccggagcgcgtc
gagctcggcaacatgctcttcttcgaaccgcggatctccagcagcggcgtgatcagctgc
gccacctgtcacaatccggcgcttggctggagcgaccgcatcccgcgagccgttggacac
gaaggccaggtgggcgaacgcaacaccccgaccgtactcaactccgggttcttcgaggcg
cagttctgggacggccgtgcggccgacctggaagagcaggcgctcggcccgatcgaggcc
gatatcgagatggcgatgtcactcgacgaggccatcgctcgcctgaacgagttcgacatc
tacaagaagaagttcgccgccgccttccccggtgacgagaacccgatccgcgaggagaac
gtcgccaaggcactcgcgagcttccagcgcacgctgaatacaccaaactcgcgtttcgac
cgctacctgaatggcgatctcgatgccctcaccgagcaggaaaagcgcggcatgaagaag
ttcgcggacagcggatgtcaggcctgtcacagcgggccggcgttcaccgacagccgcttc
caccggatccaggtgcccggttccgaggacgaggggcgcttcctggtgaccggaaaggac
tccgaccgcttcgcgttcaagaccccaaccctgcgcaacatcgcgctgacctacccctac
atgaacaacggcgccacggcgacactggaggaagcggtggcaatcatgggccaggagatg
ctcggccgtgagtacgccgaggatgaaatcggcgatttggtggccttcctgcatacccta
accggcgaaatgccgacgttcgagattccagcactgccctga

DBGET integrated database retrieval system