KEGG   Thioalkalivibrio nitratireducens: TVNIR_3203Help
Entry
TVNIR_3203        CDS       T02408                                 

Gene name
holC_[H]
Definition
DNA polymerase III chi subunit (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TVNIR_3203 (holC_[H])
   00240 Pyrimidine metabolism
    TVNIR_3203 (holC_[H])
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TVNIR_3203 (holC_[H])
   03430 Mismatch repair
    TVNIR_3203 (holC_[H])
   03440 Homologous recombination
    TVNIR_3203 (holC_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TVNIR_3203 (holC_[H])
DNA replication proteins [BR:tni03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     TVNIR_3203 (holC_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3319892..3320317
Genome map
AA seq 141 aa AA seqDB search
MTRVAFYLLAARDEQARRLFACRLARKVSRMGHHVHIHTPDAGSTDEMDRLLWTFEDIAF
LPHGTDVNDPDSPVTVHDQAAPADRCDVLINLAPEVPEYFGRFERVADLVGGDATARARG
RERYRFFKERGYPLEHHEIDP
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgtcgccttctacctgctcgcggcccgcgatgagcaagcgcggcgcctgttt
gcctgccgcctcgcgcgcaaggtcagcaggatgggccaccacgtgcacatccatacgccg
gacgcgggcagcacagacgagatggaccggctgctgtggaccttcgaggacatcgcgttc
ctgccacatggcaccgatgtcaacgatcccgacagcccggtcacggtgcacgaccaggcg
gctcccgcagaccgctgcgacgtgctgatcaacctcgcgcccgaagtgccggagtacttc
gggcgtttcgagcgcgtcgccgatctggtcggcggcgacgcgacggcacgggcacggggc
cgcgagcgctaccgcttcttcaaggaacgcggctacccgctggagcaccacgagatcgac
ccctga

DBGET integrated database retrieval system