KEGG   Thioalkalivibrio nitratireducens: TVNIR_3575Help
Entry
TVNIR_3575        CDS       T02408                                 

Gene name
fucA_[H]
Definition
Ribulose-5-phosphate 4-epimerase and related epimerase and aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TVNIR_3575 (fucA_[H])
Enzymes [BR:tni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TVNIR_3575 (fucA_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3715578..3716234
Genome map
AA seq 218 aa AA seqDB search
MRQSGTDTAERSLREGIIDTCLRMNREGINQGTSGNVSARWRDGMLITPSGIAYERLLPE
DMVFINARGKHNPGQRPSSEWRFHLAILRSRPEIAAVVHTHSLHATALAICGMEIPALHY
MIAAAGGPNIRCAPYATFGTDALSRNVVEALQDRSACLLANHGVVVTGPGLERALWLAGE
VETLAHQYILSLGLGGPRLLPDVEIDRVVRKMRHYGPR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcaatccggaacagacactgcggaacggtcgctgcgggaaggcattatcgacacc
tgcctgcgcatgaaccgcgaggggatcaaccagggcacgtcgggcaacgtcagcgcccgc
tggcgcgacggcatgctgatcacgccgtcgggaatcgcctacgaacggcttctgccggaa
gacatggtcttcatcaacgcccgcggcaaacacaaccctggtcagcggccctccagcgaa
tggcgcttccatctcgccatcctccggtcccgccccgagatcgctgcggtggtgcatacc
cactccctccatgccacggcccttgcgatctgcggcatggagattccggcactccactac
atgatcgcggccgcgggtgggccgaacatccgctgcgccccctatgcgacgtttggaacg
gacgcgctgtcccgcaacgtggtcgaggcattacaagatcgcagcgcatgcctgctcgcc
aatcacggcgtcgtcgtgaccggacccggactcgagcgcgccctctggctcgcgggggag
gtggagacactggcccaccagtacatcctgagcctgggcctcggcggcccgcgcctgctg
cctgatgtcgaaatcgaccgggtggtccggaagatgcgccattacggcccgcgctga

DBGET integrated database retrieval system