KEGG   Thioalkalivibrio nitratireducens: TVNIR_3629Help
Entry
TVNIR_3629        CDS       T02408                                 

Gene name
pcm1_[H]
Definition
Protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tni  Thioalkalivibrio nitratireducens
Brite
Enzymes [BR:tni01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TVNIR_3629 (pcm1_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3768468..3769124
Genome map
AA seq 218 aa AA seqDB search
MDFTLARVNMVEQQVRPWDVLDMRVLDVMESLPRETFVPAGREGLAYADTEIPLGHGESM
LAPRVVGRLLQALAPGDSETALEIGTGSGFVTACLARLAAQVDSVERVDEFRLAARARLE
ALGIGNASLRTATASPGWTPPRNRYDVISVNGAMTDYDPFLQSSLSLGGRLFVVVGRPPV
MHARLVIRVAEDSYRTETLFETRLKPLLGFEPRPEFVF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggatttcaccctggcgcgcgtgaacatggtggagcagcaggttcgcccctgggatgtg
ctcgacatgcgcgtcctcgacgtcatggaatcgttgcccagggaaacgttcgtgcccgcg
ggccgcgagggtttggcgtatgcggataccgagatcccgctgggtcacggcgagtcgatg
ctggccccgagagtggtcgggcgcttgctgcaggcgctggcccccggggacagcgaaacc
gcgctggagattggcaccggctccggttttgtcaccgcctgcctcgcgcggctcgcggcg
caggtcgacagcgtcgagcgcgtggacgaattccgcctggcggcccgtgcgcggttggaa
gcactcgggatcggcaatgcctctctgcgaaccgcgacggcgtcacccggctggacaccg
ccgcgaaaccgctacgacgtgatcagcgtcaacggggcgatgacggactacgacccgttc
ctgcagtcgagcctgagcctgggcgggcgcctgttcgtggtggtgggccgcccgccggtg
atgcacgcccggttggtgatccgggtcgcggaggacagctaccgcaccgagacgctgttc
gagacccggctgaaaccgctgctgggcttcgaaccgcgccccgagttcgtcttctga

DBGET integrated database retrieval system