KEGG   Thioalkalivibrio nitratireducens: TVNIR_3783Help
Entry
TVNIR_3783        CDS       T02408                                 

Gene name
sucB_[H]
Definition
Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVNIR_3783 (sucB_[H])
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TVNIR_3783 (sucB_[H])
  Amino acid metabolism
   00310 Lysine degradation
    TVNIR_3783 (sucB_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TVNIR_3783 (sucB_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3918252..3919553)
Genome map
AA seq 433 aa AA seqDB search
MPSERTALRVPELPESVADATVVALHKQPGERIRRDELLVELETDKVVLEVPAPADGVLE
EYSVEQGAVVEADTVLGYIRPGAVEEGRPDDTAERAEPTGVDDAPRRETPAPEHKAERAA
AENAPPPPSPAVRRLLTEHDLDADAIAGTGQNGRVLKDDVERFLAGRDARRRAEPQPEET
TEAEPRGQPAERAAAARPPEGRSEERVPMSRLRRRIAERLLEARQTTAMLTTFNEVDLSA
VMDLRARHKEAFEKRHRVRLGFMSFFVRACTGALQRFPVVNAALDGDEIVYHHYADIGIA
VSSPRGLVVPVLRDAGELPLAAIETQIRTFADKARDGKLDVDDLRGGTFTITNGGVFGSL
LSTPILNPPQSAILGMHAVQERPVARDGQVVIRPMMYLALSYDHRLIDGADAVRFLVSVK
ESLEDPGRMLLDL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagaacgtaccgccctccgggtccccgaactgccggaatccgtcgccgatgcc
accgtggtcgcgctgcacaagcagccgggcgagcgcatccggcgcgacgaactgctcgtc
gagctcgaaaccgacaaggtagtgctcgaagtcccggccccggccgacggggtgctcgaa
gagtacagcgtggaacagggcgcggtggtcgaggccgacacggtacttgggtacatcagg
ccgggcgccgtcgaggagggtaggccggatgatacggcggaacgcgcggagcccacaggc
gtcgacgatgccccccggcgggaaacgccggcgcccgagcacaaggccgagcgggcggcc
gccgagaacgcgccgccaccaccaagcccggcggtgcgccgcctgctgaccgagcacgac
ctcgatgcggatgcgatcgcaggtacgggccagaatggccgagtgctgaaggacgacgtg
gagcggtttcttgccgggcgcgatgcccgccgacgcgccgagccgcagccggaggagact
accgaggcggagccgcgcgggcaaccagcggagcgcgcggccgccgctcgccccccggag
ggccgcagcgaggaacgcgtgccgatgtcgcgactgcgcaggcgcatcgccgagcgcctg
ctcgaggccaggcagaccaccgcgatgctgaccaccttcaacgaggtcgacctgtcggcg
gtgatggacctgcgcgcgcggcacaaggaggcgttcgaaaagcggcaccgcgtgcgcctg
gggttcatgagcttcttcgtgcgcgcctgcaccggcgccctgcagcggtttccggtggtc
aacgcggcgctggacggcgacgagatcgtctaccaccactatgccgacatcggcatcgcc
gtgtcttcgccgcgtggcctggtggttccggtactgcgcgacgccggggagcttccgctg
gcggccatcgaaacgcagatccggacgtttgcggacaaggcacgggacggcaagctcgac
gtcgacgacctgcgcggcggcactttcaccatcaccaacggaggcgtgttcggctcgctg
ctgtcgacgccgatcctgaatccgccacagagcgcgatcctgggcatgcacgcggtgcag
gagcgcccggtggcgcgggacggccaggtggtgatccggccgatgatgtacctcgcgcta
tcctacgatcaccggctgatcgacggcgccgacgcggtgcgcttcctggtcagcgtgaag
gagtcgctggaagaccccggccggatgctgctggatctgtag

DBGET integrated database retrieval system