KEGG   Thioalkalivibrio nitratireducens: TVNIR_3828Help
Entry
TVNIR_3828        CDS       T02408                                 

Gene name
hemD_[H]
Definition
Uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TVNIR_3828 (hemD_[H])
Enzymes [BR:tni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TVNIR_3828 (hemD_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3970700..3971554)
Genome map
AA seq 284 aa AA seqDB search
MGEAGVGPLAGMHVVVTRPAAQAGPFCTMLEAQGAQVTRFPVIEIRGPADPAQLNTVLAG
LDGFDIAVFVSANAVQRVLALLRERGAWPQGVAAAAIGARTASELREHGVAPTIVPAARF
DSEALLEEPAMQQVRGRRVVIFRGDGGRPHLREILTERGAEVVYAEAYRRALPDIDATPL
RQALANRRVDAITVTSGESLQNLCRMIGRAGQVALLRTALVAGATRVAAMARDEGFAGRI
ETADDPTDTAMLAAVLRLHASGRGGEREPSEPSEPSEPSEPSAG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggcaggggtcgggccactggccgggatgcacgtggtggtgacgcgcccggcc
gctcaggccgggccattctgcacgatgctcgaggcgcagggggcacaggttacccgtttc
ccggtgatcgagatccggggccccgcggatccggcgcagctgaacacggtgctcgcaggc
ctcgatggcttcgacatcgcagtattcgtgagcgccaacgcggtgcagcgggtgctggca
ctgctgcgcgagcgcggcgcctggccacagggggttgcggccgcggccatcggcgcgcgc
accgcgtccgagttgcgtgaacacggggttgccccgacgatcgtgcccgcggcgcggttc
gacagcgaggcactgctggaggaaccggcgatgcagcaggtacgcgggcgccgggtcgtg
atcttccgcggcgacggcggtcgcccgcatctgcgcgagatccttaccgagcggggggcc
gaggtcgtctacgccgaggcctaccgacgggcgctaccggatatcgacgcgacaccgctg
cggcaggcgctggcaaaccggcgtgtcgacgcgatcacggtgaccagcggcgagagcctg
cagaacctgtgccggatgatcggaagagccgggcaggtcgcgctgctgcgcaccgcgctg
gtggcgggtgccacccgcgtcgcggcgatggcgcgggacgagggtttcgccggccggatc
gagaccgccgacgaccccaccgataccgcaatgctcgcggctgtgcttcgactgcacgca
tccggtcgaggcggcgagcgggagccgtccgagccgtccgagccgtccgagccgtccgag
ccgtccgcaggatga

DBGET integrated database retrieval system