KEGG   Thermotoga naphthophila: Tnap_0038Help
Entry
Tnap_0038         CDS       T01139                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00900  Terpenoid backbone biosynthesis
tnp01100  Metabolic pathways
tnp01110  Biosynthesis of secondary metabolites
tnp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tnap_0038
Enzymes [BR:tnp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Tnap_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ADA66146
JGI: Tnap_0038
UniProt: D2C5B0
Position
complement(33090..34220)
Genome map
AA seq 376 aa AA seqDB search
MEERTLVILGATGSIGTQTLDVLKKVKGIRLIGISFHSNLELAFKIVKEFNVKNVAVTGD
VEFEDSSINVWKGPHSIEEMLEALKPDITMVAVSGFSGLRAVLSSLEHSKRVCLANKESL
VCGGFLVKKKLKEKRTELIPVDSEHSAIFQVIEPEVEKVVLTASGGALRDWKISKIDRAR
PEDVLKHPVWNMGARITVDSATMVNKAFEVLEAMELFELPFEKIEVKIHREGLVHGAVVL
PDGNVKMVVSPPDMRIPISYALFYPRRVALEPFFLRTISLSFEDPDPEKYPAFFLLKEIK
DSYALRTAFNAADEVAVEAFLKGRIRFGGIHRVIEKTLEEFQGYPQPRTLDDVERIHFEA
IKKAERVTEWLSSTSY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagaaccctcgtgatactgggtgccactggatccataggaactcagacactc
gatgttttgaaaaaagtgaagggaattcgattgataggcatctcgtttcacagcaatctg
gagctggccttcaagatcgtgaaggaattcaacgtgaaaaacgtggcggtcacgggtgat
gtggagttcgaagacagttcgatcaacgtctggaaaggtcctcattccatagaagagatg
ctggaagcgctgaagcctgacatcacaatggtagcagtttcgggattcagtggattgagg
gcggtgctttcgtctctggagcactcgaaaagggtgtgccttgcaaacaaagaatctctc
gtgtgcggcggatttctggtgaagaaaaaactcaaagagaaaagaactgaactcattccg
gtcgatagtgaacacagtgccatctttcaggtgatagaaccagaagtggaaaaggtggtt
ttgacagcttctggaggtgctttgagagactggaaaatttccaagatcgatagagcaagg
cctgaagacgtactcaagcatcccgtgtggaatatgggagcccgtataacggtagattct
gctacaatggtgaacaaggcgttcgaagttctggaagccatggagctcttcgagctgccc
ttcgagaagatagaagtgaagatacacagagagggattggttcacggagcagtggttctg
cccgatggaaacgtcaaaatggtggtgtcaccaccggatatgagaataccgataagttat
gcccttttctatccgagacgcgtcgctcttgaaccgttttttctgaggaccattagcctt
tcttttgaagatcccgatcccgaaaaataccctgcgttctttcttctgaaagagataaag
gattcttacgctctgagaacagctttcaacgcggcagatgaagtggcagtcgaagccttt
ttgaaggggagaataaggttcggtggtatccacagagtgatagagaaaactctcgaagag
tttcaaggatatccacagccacgaacgctggatgatgtggagcgaattcatttcgaagcg
ataaaaaaagcggagagggtgacagaatggttatcgtctacttcatattga

DBGET integrated database retrieval system