KEGG   Thermotoga naphthophila: Tnap_0257Help
Entry
Tnap_0257         CDS       T01139                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tnp  Thermotoga naphthophila
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Tnap_0257
Enzymes [BR:tnp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Tnap_0257
    3.5.1.-  
     Tnap_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(256366..256890)
Genome map
AA seq 174 aa AA seqDB search
MRALLVIDLQRDFVDRGGALYFEGAEKVIDPILKWVEEFKKENLPIITTQDWHDPEDREF
SLWPKHCVANTDGARLTEKLEKALEDYPNHFSVKKNRYSAFYNTNLEKIIRDNEIDEVYV
CGVVTHICVLFTVEELRNRDIPVKIITEGVASYDEELHRFALREMKEILGAEFI
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgagagcccttcttgtgatagaccttcagagagatttcgtggacagaggaggtgctctt
tacttcgaaggagcagagaaggtgatcgatcccattttgaagtgggttgaagagttcaaa
aaggagaacctccccatcatcaccacccaagactggcatgatcctgaagacagagaattc
agcctctggccgaaacactgtgttgcgaacaccgatggtgcaagactcaccgaaaagctc
gagaaagccctggaagactatcccaatcacttctctgtgaagaaaaaccgatacagtgcc
ttctacaacacgaatcttgaaaagataatcagagacaacgagatagacgaagtttacgtt
tgtggagttgtaacacacatctgtgtgctcttcaccgtcgaagagttgagaaacagggat
atccctgttaaaataatcactgaaggcgttgcttcttacgatgaagagcttcaccgcttt
gcactgagggaaatgaaagaaattttaggagcagaattcatttga

DBGET integrated database retrieval system