KEGG   Thermotoga naphthophila: Tnap_0326Help
Entry
Tnap_0326         CDS       T01139                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00260  Glycine, serine and threonine metabolism
tnp00750  Vitamin B6 metabolism
tnp01100  Metabolic pathways
tnp01110  Biosynthesis of secondary metabolites
tnp01120  Microbial metabolism in diverse environments
tnp01230  Biosynthesis of amino acids
Module
tnp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tnap_0326
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tnap_0326
Enzymes [BR:tnp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tnap_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADA66429
JGI: Tnap_0326
UniProt: D2C643
Position
complement(325387..326427)
Genome map
AA seq 346 aa AA seqDB search
MGILEKYRRFLPVTDKTPMLSLNEGNTPLIPLVNMSRELGINIYVKYEGSNPTGSFKDRG
MVVAVAKALEEGSKAIMCASTGNTSASAAAYAARAGIKAIVLIPEGKIALGKLAQAMIYG
AVVLQVRGNFDKCLELVKEITSKYPITLVNSINPYRLEGQKTAAFEIVDELGDAPDYHFI
PVGNAGNISAYWMGYKEYYQHGFSTKLPKMMGFQAEGAAPIVRGHPIENPETVATAIRIG
NPANWEKAVRARDESGGDIDMVSDEEILRAQRLLAQKEGIFCEPASAASIAGLLKKHRQG
IFRGGEIVVCTLTGNGLKDPNIVISQLEPPRTIEGRVEEILEVLDI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttgggcatactcgaaaagtacagaagatttcttcccgtaacagacaaaacccccatgctc
tctttgaatgaagggaacactcctctcatacctcttgtgaacatgagcagggaactcgga
ataaacatctacgtgaagtacgaaggatccaatccgacggggtccttcaaagatagagga
atggtcgttgccgtcgcaaaggcactggaagaaggctcgaaagccatcatgtgcgcttca
acggggaacacctccgcatccgctgccgcgtacgccgcaagggcgggaataaaggcgatc
gttctgataccagaagggaagatcgcactcggaaagctggctcaggcgatgatatacggc
gccgtggtgcttcaggtgagagggaatttcgacaagtgtctggaactggtcaaggagatc
acatccaaatatcccatcacactcgtgaacagtatcaatccctacagactcgaaggtcag
aaaacggccgcttttgagatagtcgacgagctcggagatgcaccggactaccacttcatc
cccgtgggaaacgcgggcaacatctccgcttactggatgggatacaaggagtattatcag
catggattctccaccaagcttccaaagatgatgggattccaggcggaaggggccgccccc
atagttcgcggtcatcccatagaaaacccggagacggtcgccactgcaataaggatcggt
aaccccgcgaactgggaaaaagcggtccgggcacgcgatgaatcgggtggagacatcgac
atggtgagcgacgaagaaatactgcgcgcacagagactcttggctcagaaagaagggatc
ttctgtgagcccgcatccgctgcatcgatagcggggcttttgaagaagcacagacaggga
atcttcaggggtggagagatcgttgtgtgtaccctcacagggaacggtttgaaagatccg
aacatcgtcatctcacagctcgaacccccaaggaccatagaaggaagagtagaagagatt
ctggaggtactcgacatatga

DBGET integrated database retrieval system