KEGG   Thermotoga naphthophila: Tnap_0326Help
Entry
Tnap_0326         CDS       T01139                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tnp  Thermotoga naphthophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tnap_0326
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tnap_0326
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tnap_0326
Enzymes [BR:tnp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tnap_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(325387..326427)
Genome map
AA seq 346 aa AA seqDB search
MGILEKYRRFLPVTDKTPMLSLNEGNTPLIPLVNMSRELGINIYVKYEGSNPTGSFKDRG
MVVAVAKALEEGSKAIMCASTGNTSASAAAYAARAGIKAIVLIPEGKIALGKLAQAMIYG
AVVLQVRGNFDKCLELVKEITSKYPITLVNSINPYRLEGQKTAAFEIVDELGDAPDYHFI
PVGNAGNISAYWMGYKEYYQHGFSTKLPKMMGFQAEGAAPIVRGHPIENPETVATAIRIG
NPANWEKAVRARDESGGDIDMVSDEEILRAQRLLAQKEGIFCEPASAASIAGLLKKHRQG
IFRGGEIVVCTLTGNGLKDPNIVISQLEPPRTIEGRVEEILEVLDI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttgggcatactcgaaaagtacagaagatttcttcccgtaacagacaaaacccccatgctc
tctttgaatgaagggaacactcctctcatacctcttgtgaacatgagcagggaactcgga
ataaacatctacgtgaagtacgaaggatccaatccgacggggtccttcaaagatagagga
atggtcgttgccgtcgcaaaggcactggaagaaggctcgaaagccatcatgtgcgcttca
acggggaacacctccgcatccgctgccgcgtacgccgcaagggcgggaataaaggcgatc
gttctgataccagaagggaagatcgcactcggaaagctggctcaggcgatgatatacggc
gccgtggtgcttcaggtgagagggaatttcgacaagtgtctggaactggtcaaggagatc
acatccaaatatcccatcacactcgtgaacagtatcaatccctacagactcgaaggtcag
aaaacggccgcttttgagatagtcgacgagctcggagatgcaccggactaccacttcatc
cccgtgggaaacgcgggcaacatctccgcttactggatgggatacaaggagtattatcag
catggattctccaccaagcttccaaagatgatgggattccaggcggaaggggccgccccc
atagttcgcggtcatcccatagaaaacccggagacggtcgccactgcaataaggatcggt
aaccccgcgaactgggaaaaagcggtccgggcacgcgatgaatcgggtggagacatcgac
atggtgagcgacgaagaaatactgcgcgcacagagactcttggctcagaaagaagggatc
ttctgtgagcccgcatccgctgcatcgatagcggggcttttgaagaagcacagacaggga
atcttcaggggtggagagatcgttgtgtgtaccctcacagggaacggtttgaaagatccg
aacatcgtcatctcacagctcgaacccccaaggaccatagaaggaagagtagaagagatt
ctggaggtactcgacatatga

DBGET integrated database retrieval system