KEGG   Thermotoga naphthophila: Tnap_0501Help
Entry
Tnap_0501         CDS       T01139                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tnp  Thermotoga naphthophila
Brite
Enzymes [BR:tnp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tnap_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Ubie_methyltran Methyltransf_31 Methyltransf_25 Methyltransf_3 CMAS Methyltransf_11 Fibrillarin Methyltransf_23 GCD14 MTS Methyltr_RsmB-F Methyltransf_4 Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: ADA66597
JGI: Tnap_0501
UniProt: D2C6L1
Position
499917..500870
Genome map
AA seq 317 aa AA seqDB search
MREKLFWILKKYGVSDHIAKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQ
PSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNV
ERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDEVPETWFTQLKEGGRVIVPINLKLS
RRQPAFLFKKKDPYLVGNYKLETRFITAGGNLGNLLERNRKLLREFPFNREILLVRSHIF
VELVDLLTRRLTEIDGTFYYAGPNGVVEFLDDRMRIYGDAPEIENLLTQWESCGYRSFEY
LMLHVGYNAFSHISCSI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaagctcttttggattcttaaaaagtacggtgtgagcgatcacatcgcgaag
gcttttctggaaataccccgtgaggagttcctgacgaagtcctacccactctcttacgtt
tacgaggatatcgttctggtttcctacgatgatggagaagaatacagcacttccagtcag
ccctctttgatggcgctgtttatggagtgggtgggtctggacaaaggaatgagagtcctc
gaaataggcggaggaacgggttacaacgctgccgtgatgagcagagttgtgggtgagaaa
ggccttgtggtctccgtggaatattcgaggaaaatctgcgagatcgcgaaaaggaacgtg
gaacgccttggaatagagaacgttatttttgtctgtggcgatggatactacggtgttccg
gagttttccccgtacgatgttatcttcgtaacagtcggtgtggatgaggtgccggagacg
tggttcactcaactcaaagaaggtgggagggtgatagtacctatcaatttgaaactttca
agaagacagcccgctttcctgttcaaaaaaaaggatccgtatcttgtgggaaactacaaa
ctggaaaccaggttcataacggcagggggcaatctcggaaatcttctcgagaggaacaga
aagcttttgagagaatttccattcaacagagagatcttactcgtacgttctcatatcttc
gtggagctggtggatctcctcaccaggagactcacagagattgatggaacgttctactac
gctgggccaaacggcgtggtagagtttctcgatgacaggatgagaatctacggggacgct
ccagagatagagaaccttttaactcagtgggaaagctgcggctacaggagcttcgagtat
ctcatgcttcatgtgggttacaacgctttttcacatatatcctgttctatttga

DBGET integrated database retrieval system