KEGG   Thermotoga naphthophila: Tnap_0646Help
Entry
Tnap_0646         CDS       T01139                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tnp  Thermotoga naphthophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tnap_0646
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tnap_0646
   00020 Citrate cycle (TCA cycle)
    Tnap_0646
   00620 Pyruvate metabolism
    Tnap_0646
   00640 Propanoate metabolism
    Tnap_0646
   00650 Butanoate metabolism
    Tnap_0646
  Energy metabolism
   00680 Methane metabolism
    Tnap_0646
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tnap_0646
Enzymes [BR:tnp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tnap_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
664973..665551
Genome map
AA seq 192 aa AA seqDB search
MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIG
DEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKIC
VVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRA
LRRGYEEVKCSE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttgcgaagaaatactttgaaatacgatggcacggtagagccgggcagggtgca
aagagcgcttcccagatgttggcagaagccgctctggaagccggaaaatacgttcaggct
tttccagaatacggtgcagaaagaacaggtgctcccatgagggccttcaacaggattggt
gatgagtacatcagagtgagatctgcagtggaaaacccggacgtcgttgtggtgatcgat
gaaacactactttctcccgccattgtagaaggcctttcagaagatggtatcctccttgtg
aacaccgttaaggatttcgaattcgtcagaaaaaagacaggattcaacggaaagatatgc
gtggtggatgctacagacatcgctctccaggagataaagagaggaataccgaacacaccg
atgcttggagcgctggtcagagtgacaggtattgtgcctctcgaggcgatagagaagaga
atcgagaagatgttcggaaagaaattccctcaggaagtgattgatgcgaacaagagagct
ttgagacgtggatatgaggaagtaaagtgctcagagtga

DBGET integrated database retrieval system