KEGG   Thermotoga naphthophila: Tnap_0646Help
Entry
Tnap_0646         CDS       T01139                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00010  Glycolysis / Gluconeogenesis
tnp00020  Citrate cycle (TCA cycle)
tnp00620  Pyruvate metabolism
tnp00633  Nitrotoluene degradation
tnp00640  Propanoate metabolism
tnp00650  Butanoate metabolism
tnp00680  Methane metabolism
tnp01100  Metabolic pathways
tnp01120  Microbial metabolism in diverse environments
tnp01130  Biosynthesis of antibiotics
tnp01200  Carbon metabolism
Module
tnp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tnap_0646
   00020 Citrate cycle (TCA cycle)
    Tnap_0646
   00620 Pyruvate metabolism
    Tnap_0646
   00640 Propanoate metabolism
    Tnap_0646
   00650 Butanoate metabolism
    Tnap_0646
  Energy metabolism
   00680 Methane metabolism
    Tnap_0646
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tnap_0646
Enzymes [BR:tnp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tnap_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADA66742
JGI: Tnap_0646
UniProt: D2C706
Position
664973..665551
Genome map
AA seq 192 aa AA seqDB search
MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIG
DEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKIC
VVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRA
LRRGYEEVKCSE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttgcgaagaaatactttgaaatacgatggcacggtagagccgggcagggtgca
aagagcgcttcccagatgttggcagaagccgctctggaagccggaaaatacgttcaggct
tttccagaatacggtgcagaaagaacaggtgctcccatgagggccttcaacaggattggt
gatgagtacatcagagtgagatctgcagtggaaaacccggacgtcgttgtggtgatcgat
gaaacactactttctcccgccattgtagaaggcctttcagaagatggtatcctccttgtg
aacaccgttaaggatttcgaattcgtcagaaaaaagacaggattcaacggaaagatatgc
gtggtggatgctacagacatcgctctccaggagataaagagaggaataccgaacacaccg
atgcttggagcgctggtcagagtgacaggtattgtgcctctcgaggcgatagagaagaga
atcgagaagatgttcggaaagaaattccctcaggaagtgattgatgcgaacaagagagct
ttgagacgtggatatgaggaagtaaagtgctcagagtga

DBGET integrated database retrieval system