KEGG   Thermotoga naphthophila: Tnap_0646Help
Entry
Tnap_0646         CDS       T01139                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, gamma subunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
tnp  Thermotoga naphthophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:tnp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tnp00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tnp00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tnp00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tnp00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tnp00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:tnp00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:tnp00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
664973..665551
Genome map
AA seq 192 aa AA seqDB search
MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIG
DEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKIC
VVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRA
LRRGYEEVKCSE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttgcgaagaaatactttgaaatacgatggcacggtagagccgggcagggtgca
aagagcgcttcccagatgttggcagaagccgctctggaagccggaaaatacgttcaggct
tttccagaatacggtgcagaaagaacaggtgctcccatgagggccttcaacaggattggt
gatgagtacatcagagtgagatctgcagtggaaaacccggacgtcgttgtggtgatcgat
gaaacactactttctcccgccattgtagaaggcctttcagaagatggtatcctccttgtg
aacaccgttaaggatttcgaattcgtcagaaaaaagacaggattcaacggaaagatatgc
gtggtggatgctacagacatcgctctccaggagataaagagaggaataccgaacacaccg
atgcttggagcgctggtcagagtgacaggtattgtgcctctcgaggcgatagagaagaga
atcgagaagatgttcggaaagaaattccctcaggaagtgattgatgcgaacaagagagct
ttgagacgtggatatgaggaagtaaagtgctcagagtga

DBGET integrated database retrieval system