KEGG   Thermotoga naphthophila: Tnap_0648Help
Entry
Tnap_0648         CDS       T01139                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
tnp  Thermotoga naphthophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tnap_0648
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tnap_0648
   00020 Citrate cycle (TCA cycle)
    Tnap_0648
   00620 Pyruvate metabolism
    Tnap_0648
   00640 Propanoate metabolism
    Tnap_0648
   00650 Butanoate metabolism
    Tnap_0648
  Energy metabolism
   00680 Methane metabolism
    Tnap_0648
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tnap_0648
Enzymes [BR:tnp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tnap_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
665866..667044
Genome map
AA seq 392 aa AA seqDB search
MERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGVVRTEMIPVE
SEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPINI
HCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHEDVRLPVMVNLDGFILSHGVE
PVEFYPDELVKKFVGELKPMYPLLDTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKVFP
EIAKEFEETFGRKYWFVEPYRMEDAEHVMVALGSTNSTIKYVVDELREEGYKVGSLKIWM
FRPFPKEQLQELLNGRKSVVVLDRAVSFGAEAPLYEAVKSALYEVAARPMLGSYVYGLGG
RDIKPEHIRKAFEDAINGNLIADEQRYLGLRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggtcgtcgagagagtggccgtcaccggcgctgaggccgttgccaatgcgatg
agacagatagagcccgatgtcgttgcggcgtacccgatcactccacagacacctattgtg
gagtacttcgccaggttcgtcgcggacggcgttgtcaggacagaaatgattcccgtcgaa
agtgaacacagtgcgatgagcgctgtcgttggagccgctgccgcgggagcaagagcgatg
acagcaaccagtgcaaatggactcgcactgatgcacgaaatagtttacatcgctgcctcc
tacagacttcccattgtgatgcccgttgtgaacagagcgctcagtggtcctataaacatt
cactgtgaccacagcgacgcgatggcagaaagggattctggatggattcagctctttgcg
gaaactaatcaggaggcttacgatttcaccattctcgctgtgagactggcagaacacgaa
gatgtgagacttcccgtcatggtgaacctcgatgggttcatcctttctcacggagtggaa
cccgttgagttctatcccgatgaactcgtgaagaagttcgttggagagctcaaacccatg
tatcctcttctggatactgaacaccctgtaacctggggtcctctcgatctttacgattac
tacttcgaacacaaaagacagcagattgaagccatggaaaacgtaaagaaggtgttcccg
gaaatcgcaaaagaattcgaagaaacgtttggaaggaaatactggtttgtcgaaccgtac
agaatggaagatgcagagcacgtgatggtagcactgggctccacaaacagcacgataaag
tacgtggttgatgaactgagagaagaaggctacaaagttggatctttgaaaatctggatg
ttcagaccgttcccgaaggagcagcttcaggaactcctcaacggaagaaagagtgtagtt
gtgctcgacagagctgtttccttcggagcggaagcacctctctacgaagcagtgaaatct
gcgctctacgaagtagcagcgaggccgatgcttggatcctatgtctacggtctcggtgga
agggacatcaaaccagagcacatcagaaaagcgttcgaagatgccataaacggaaacctc
atagcagatgaacagagatatcttggtctcagagagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system