KEGG   Thermotoga naphthophila: Tnap_0649Help
Entry
Tnap_0649         CDS       T01139                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tnp  Thermotoga naphthophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tnap_0649
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tnap_0649
   00020 Citrate cycle (TCA cycle)
    Tnap_0649
   00620 Pyruvate metabolism
    Tnap_0649
   00640 Propanoate metabolism
    Tnap_0649
   00650 Butanoate metabolism
    Tnap_0649
  Energy metabolism
   00680 Methane metabolism
    Tnap_0649
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tnap_0649
Enzymes [BR:tnp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tnap_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
667059..668033
Genome map
AA seq 324 aa AA seqDB search
MPVNIKQLAQEFDKKEIGITQGHRLCPGCGAPITVKFVMMIARHLGYEPVVGLATGCLEV
STSIYPYTAWSVPYIHNAFENVAATMSGVETAYKALKNKGKIPEDKKYAFIAFGGDGGTY
DIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTTTAPVGKKLPGKVQLK
KNIVEIVAAHENVYAATASLSEPMDFFAKVEKALNFDGPSFLAVFSPCVRFWRVNDDKTV
EISKLAVETKYWPLYEVERGVYRVTRKPRQFKPVEEFLKAQGRFRKLLSRPDAKEIVDEL
QEYVDRRWERLLTLEEVTKDKPIR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttaacataaaacagctggcacaggagttcgataagaaagaaatcggtatcaca
cagggtcacaggctctgtccaggttgtggagcacccatcacagtgaagttcgtgatgatg
atcgcaagacacctcggatacgaacccgttgttggactcgcaacaggttgtctggaggtt
tctacctccatctatccgtacaccgcttggagcgtaccttacattcacaacgcctttgaa
aacgtggcagcaacgatgagcggtgtggaaacggcttacaaagcactgaaaaacaaagga
aagatcccagaagacaaaaaatacgccttcattgcttttggtggagacggtggaacgtac
gatatcggtcttcagtcactgtccgggatgctcgaaagaggtcacaaggtgctctacgtc
ctctacgacaacgagggatacatgaacacaggaaaccagagatccggatccacacccccg
ggttcggataccacgacagctccagttggaaagaagctccctggaaaggtccagctgaaa
aagaacatcgtcgagatcgtagcggctcacgagaacgtctacgcagctaccgcatcgctc
tctgaacccatggacttctttgccaaggtggaaaaggcgctgaacttcgatggaccttct
ttccttgcggtcttctctccttgcgtcaggttctggagagtgaacgacgataaaacagta
gaaatatcaaaactcgccgtagaaacgaagtactggcctttgtacgaagtggaaagagga
gtttacagagtcaccagaaaaccgagacagttcaaacctgtggaggaattcctgaaggct
cagggaaggttcagaaaacttctttcaagaccggatgcaaaagaaatcgtagacgaactc
caggaatacgtcgacagaagatgggaaagactactcacactggaagaggttacaaaggac
aaaccgattagataa

DBGET integrated database retrieval system