KEGG   Thermotoga naphthophila: Tnap_0672Help
Entry
Tnap_0672         CDS       T01139                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tnp  Thermotoga naphthophila
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tnap_0672
Enzymes [BR:tnp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Tnap_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
692187..692651
Genome map
AA seq 154 aa AA seqDB search
MAKVVIALGSNLGDRQRNIEKALEEMNKRNIKVETVSSIIETEPYGYEDQPRFLNAVCIA
QTPLSPHELLNTLLQIERNMGRVRTIRWGPRIIDLDIVFYEDLVLSEEDLIIPHPDAHNR
TFVLEPLCEIAPDLIHPVMGKTVRELLEDLRRRR
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
ctggcaaaggttgtaatagcgcttggaagcaacctcggtgacaggcagagaaacatagaa
aaagcccttgaggaaatgaacaagagaaatataaaggtagaaacagtatcctccataatc
gaaacagaaccatacggctacgaagatcaaccgaggttcctgaacgcggtttgtatcgca
caaacaccgctttctcctcacgaactgctgaatacacttctccaaatagagagaaacatg
ggaagagtgagaacgatacggtggggacccaggatcatcgatctcgacatcgtattctat
gaagatcttgttctcagcgaagaagacctcataataccccatcccgatgcgcacaacaga
acgtttgtcctggaaccactgtgcgagatagctccagatttaatccatcctgtgatggga
aagacagtgagagaactactggaagatctcagacgacgaagatag

DBGET integrated database retrieval system