KEGG   Thermotoga naphthophila: Tnap_0768Help
Entry
Tnap_0768         CDS       T01139                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tnp  Thermotoga naphthophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tnap_0768
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tnap_0768
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tnap_0768
Enzymes [BR:tnp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tnap_0768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(794176..795345)
Genome map
AA seq 389 aa AA seqDB search
MKGYFGPYGGQYVPEILMPALEELEAAYEGIMKDGSFWREFNDLLRDYAGRPTPLYFARR
LSEKYNARIYLKREDLLHTGAHKINNAIGQVLLAKRMGKTRIIAETGAGQHGVATATAAA
LFGMECVIYMGEEDTIRQKPNVERMKLLGAKVVPVKSGSRTLKDAINEALRDWITNLQTT
YYVIGSVVGPHPYPIIVRNFQKVIGEETKKQILEKEGRLPDYIVACVGGGSNAAGIFYPF
IDSGVKLIGVEAGGEGLETGKHAASLLKGKIGYLHGSKTFVLQDDWGQVQVTHSVSAGLD
YSGVGPEHAYWRETGKVLYDAVTDEEALDAFIELSRLEGIIPALESSHALAYLKKINIKG
KVVVVNLSGRGDKDLESVLNHPYVRERIG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttactttggtccttacggaggtcagtacgttcccgagattctcatgcctgcc
cttgaagaactcgaggcggcttacgagggaatcatgaaggatggatcgttctggagagag
ttcaacgaccttctaagggattacgctggacgccccactcctctttacttcgccagaagg
ttgagtgaaaagtacaacgccaggatttatttgaagcgtgaagatcttcttcacacaggt
gctcacaagataaacaacgccataggtcaggtgcttctcgcgaagaggatgggaaaaaca
agaataatagcggaaacaggagcggggcagcacggcgttgccaccgcgacggccgctgcg
ctctttggaatggagtgcgtcatatacatgggcgaagaagacacgatcagacagaaaccc
aacgttgagagaatgaaactcctcggcgcgaaagtggttcccgtgaagagcggaagcaga
acgctgaaagacgccataaacgaagcccttcgggattggatcacgaaccttcagaccacc
tactacgttatcggatccgtcgtgggacctcacccgtatccgatcatagtgagaaacttt
cagaaggtgattggtgaggaaacaaaaaagcagatccttgagaaggaagggagattgccg
gattacatcgttgcgtgtgttggaggaggaagcaacgctgccggtatcttctacccgttc
atagattccggtgtgaagctgatcggagtggaagccggtggagaaggcctcgaaaccgga
aagcacgcagcttctcttctcaaagggaaaattggatacctacacggaagtaagaccttc
gttcttcaggatgactggggccaggttcaggtgacacactcggtttcggcgggactggac
tattccggtgtggggcctgaacacgcttattggagggagactggaaaagttctgtacgat
gcggtgacggatgaagaagctctcgatgccttcatcgaactttcaaggctggaagggatc
attccagcactcgaaagctctcacgcactggcttacctgaagaagatcaatataaagggt
aaggtcgtcgttgtgaacctttcagggcgcggcgacaaggatttagaatcagttttgaac
catccgtacgtcagggagaggataggatga

DBGET integrated database retrieval system