KEGG   Thermotoga naphthophila: Tnap_0785Help
Entry
Tnap_0785         CDS       T01139                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tnp  Thermotoga naphthophila
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tnap_0785
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Tnap_0785
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tnap_0785
Enzymes [BR:tnp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Tnap_0785
Exosome [BR:tnp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tnap_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(812575..813879)
Genome map
AA seq 434 aa AA seqDB search
MKRLFTLILISLLVALVFSQVKNVIYFIGDGMGLSQVYLTSMLEGRPLSLMKTPYIGLVK
THSANSWVTDSAAAGTALASGFKTNNGMINILPDGTVVPTIFEVAKTYGVRTGIVVTCRV
THATPAAFYAHVKSRDEENEIARQLVENETVDVVMGGGWANFLPKDLGGKRDDNLNLIEL
AKEKGYIYVKTREELSKISADSDKILALFAPSHLDPASSRKEQPMLYEMVEKVLEILSKD
DEPFFLMVEGSQIDWEAHDNDIYGVWKEVKEFDKAVQVALDFALKRGDTLVIVTADHETG
GLGLSSGDYRVDVDKIRNFKKTTDWIMANYSPKDQEKFKKAIEEYFGLTLSDEDLNRISM
SKNPKIELGRILGEKVSVGWTTTTHSGTPVPIFAFGPGAENFTGFLDNTEIPRIIMKLTG
YSLQYPLLKEPVTK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggctttttacgctgatactgatttccctgctggtcgcgctcgttttttctcag
gtgaaaaacgttatctatttcattggagatggtatgggtctttctcaagtctatctcacc
agcatgctcgaaggaagaccactctcgctcatgaagactccttacatcggacttgtgaag
acacactccgcaaacagctgggtgactgattccgcagcagcgggcacagcgctggcatcg
gggttcaaaacgaacaacggtatgatcaacattctccccgatggaacggtggtacccact
atcttcgaagtggcaaagacctacggagttcgaacgggtatcgttgttacctgcagagta
acacatgcgacgccggctgctttctacgcacacgttaaaagtagagatgaagagaacgaa
atagcaagacaactcgttgagaatgaaacagtcgatgtggtgatggggggaggttgggca
aactttcttcccaaggatctcggtggaaaacgagatgacaacctcaacttgattgaactt
gcaaaagaaaaagggtatatatacgtgaaaaccagagaggaactctcaaaaatctccgcg
gattcagataaaatactcgctctctttgcaccaagtcacctggatcctgcaagtagcaga
aaggagcagccgatgctctatgaaatggtggaaaaagtgctcgagatactgtcgaaagat
gatgaacccttcttcctcatggtggaaggctcccagatagactgggaagcccacgataac
gacatctacggggtctggaaagaagtcaaggaattcgacaaagccgttcaggtggcgctt
gatttcgccctcaagaggggagacaccctcgtcattgtaactgccgaccacgaaacgggt
ggattagggctttcttcgggcgactacagagtagatgtggacaaaatcagaaacttcaaa
aaaacaacggactggatcatggcaaattactctccaaaagatcaagagaaattcaaaaag
gccatcgaagagtatttcggtttgactctttctgatgaggatctgaacaggatttccatg
tccaaaaatccaaagatcgaacttggaaggatcctgggagaaaaggttagcgttgggtgg
accaccacaacacattcaggaactcccgttcccatcttcgcttttggtccgggtgccgaa
aacttcaccggatttctcgacaacaccgagattccaaggatcataatgaaactcacaggg
tactctcttcaatatccacttctgaaagaacccgtaacgaaatga

DBGET integrated database retrieval system