KEGG   Thermotoga naphthophila: Tnap_0795Help
Entry
Tnap_0795         CDS       T01139                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tnp  Thermotoga naphthophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tnap_0795
Enzymes [BR:tnp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tnap_0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(821490..822056)
Genome map
AA seq 188 aa AA seqDB search
MIAGISGRVLKKSGNVLLVETKSGVVFEIVCDVQTSEEVKEGEECFLHTFLNVSQDGITL
YGFSNERKKELFLSLTKVSRLGPKTALKIISNEDAETLVTMIASQDVEGLSKLPGISKKT
AERIVMELKDEFESAGIKDMRIYHESLEALVSLGYPEKQAREAVKHVYREGMKTSELIKE
ALKFLSQR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgggaatctctggaagagtcttgaaaaagagtggaaacgttctcctcgtggaa
acaaaatctggagtcgtctttgaaatcgtctgcgatgttcagaccagtgaagaagtgaaa
gaaggcgaagaatgttttcttcacacgtttttgaacgtttcgcaggacggaattaccctc
tatgggttttcaaatgagagaaaaaaggaactcttcctttctctcacaaaggtttccagg
cttgggccaaaaacggccttgaagatcatctcgaacgaagatgcggaaacactggtgaca
atgatcgcctctcaggacgtggaaggcctttcaaaacttcccggcatcagtaagaaaaca
gcagaacggatcgtgatggaattgaaagatgaattcgaaagtgctggaataaaagacatg
agaatctatcacgaatctttagaagccctggtgtcactgggatacccggagaaacaggca
agagaagcggtgaaacacgtgtacagagagggaatgaaaacatccgagttgataaaagaa
gctttaaagtttctgagtcaaagatag

DBGET integrated database retrieval system