KEGG   Thermotoga naphthophila: Tnap_0839Help
Entry
Tnap_0839         CDS       T01139                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tnp  Thermotoga naphthophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tnap_0839
   01230 Biosynthesis of amino acids
    Tnap_0839
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tnap_0839
   00030 Pentose phosphate pathway
    Tnap_0839
   00051 Fructose and mannose metabolism
    Tnap_0839
   00052 Galactose metabolism
    Tnap_0839
  Energy metabolism
   00680 Methane metabolism
    Tnap_0839
Enzymes [BR:tnp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tnap_0839
Protein phosphatases and associated proteins [BR:tnp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tnap_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(875936..876895)
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAVVRYGVRHGLEVIGVRRGYSGLIDGDFVKLEYKDVAGI
TEKGGTILRTSRCEEFKTEEGRELAAKQIKKHGIEGLVVIGGEGSLTGAHLLYEEHKIPV
VGIPATIDNDIGLTDMCIGVDTCLNTVMDAVQKLKDTASSHERAFIVEVMGRHSGYIALM
AGLVTGAEAIIVPEIPVDYSQLADRILEERRRGKINSIIIVAEGAASAYTVARHLEYRIG
YETRITILGHVQRGGSPTASDRRLALSMGVEAVDALLDGEVDVMIALQGNKLVRVPIMEA
LSTKKTIDKKLYEIAYMLS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagatagcagttcttacaagcggtggagacgcacctggaatgaacgcagctgtg
agggcggtcgtcaggtacggcgtcaggcatgggctggaagtgataggtgtgagaagaggt
tactcaggcctcatcgacggtgactttgtaaaactcgaatacaaagatgtggcaggaatc
acagaaaagggtggaacaattctgagaacttccagatgtgaggagttcaagacagaagag
ggcagagaactcgctgcgaaacagataaaaaaacatggtatagaaggacttgttgtcata
ggtggtgaggggagtctcaccggcgctcatctcctttacgaagagcacaaaatacccgtc
gtcggtatcccagcgaccatagacaacgacatcggattgaccgacatgtgcataggtgtg
gacacgtgtttgaacacggtgatggacgctgttcaaaagctcaaagacactgccagttcg
catgagagagctttcattgtggaagtcatggggagacactccggctacatcgctctcatg
gcgggactggtgactggtgcagaagccatcatagtaccagagattcctgtggattattca
cagctcgccgataggatcctcgaagaaagaagaagaggaaagatcaacagcataatcata
gtcgctgaaggtgcagcgagtgcctacaccgttgcaagacaccttgaatacaggataggc
tacgaaacgaggattaccatcctcggacacgtacagagaggtggctctccaacggcttcc
gacagaagattggcactaagtatgggagttgaagcggtcgatgcccttctggacggagag
gtagatgtgatgatagctcttcagggtaacaagctcgtgagagtccccataatggaagcg
ctctctacgaaaaaaacgatcgacaagaaactctacgaaatagcctatatgctttcatga

DBGET integrated database retrieval system