KEGG   Thermotoga naphthophila: Tnap_0855Help
Entry
Tnap_0855         CDS       T01139                                 

Definition
pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase family
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
tnp  Thermotoga naphthophila
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Tnap_0855
Enzymes [BR:tnp01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Tnap_0855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
891108..892046
Genome map
AA seq 312 aa AA seqDB search
MRIDLSLKPTPVQFLKRLSEEYGFNIYVKRDDLTELVGSGNKIRKLEYLLWEALKKGATT
VFTCGGLQSNHARATAYVSRKHGLKPVLFLRKGEKVLNGNLLLDILLGAEIVEVSQEEYE
RIDEIFDVHKKMREKKGEKVYVIPEGGSNSLGAFGYFNAVLEMKDQLNLESFDAIVCAVG
SGGTIAGLSAGISFLEYHVPVVGVNVTTKNSDYFVGKVKRIISGMEEHGLKINETVFKVV
DDYRGPGYAIPSSEDVEILKEVASIESIILDPVYTAKAFRGMIEMFRNSGKNVLFIHTGG
IFGLFAQSGRLV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgatctttcccttaaacccacacctgttcagtttctcaaaagactctcggaa
gaatacgggttcaacatctacgttaaaagagacgatctcacagagcttgtgggatcgggc
aacaaaatcagaaagctggagtatcttctctgggaagctcttaaaaaaggagcaacaact
gtcttcacctgtggaggtcttcagtcgaaccatgccagagcaacggcatacgtttcgaga
aaacacggtttgaaacctgttctcttcctcagaaaaggagagaaggttctgaacggaaat
cttctcctcgacattctcctcggtgctgaaatagtggaagtttcccaggaagagtacgaa
cgcatcgatgagatcttcgatgttcacaaaaagatgagagagaagaaaggtgaaaaggtg
tacgtgatacccgaagggggatcgaactcccttggggcctttggctacttcaatgcggtg
ctggagatgaaagatcaattgaacctcgaatctttcgatgctatcgtgtgtgctgttgga
agtggtggaaccatagcgggtttgtcagctggaatttcctttctggaatatcacgtacct
gtggtgggtgtgaacgtcaccacgaaaaactcggattattttgtggggaaggtgaaaaga
ataattagtggtatggaagagcatggtctgaagatcaacgaaactgttttcaaagtggtg
gacgattacagagggccgggatatgcgattccgtccagtgaggatgtggagatcttgaaa
gaagtagcttcgatagaaagtatcatcctcgatccggtctacacggcaaaagccttcaga
ggaatgatcgaaatgttcagaaattcaggaaagaacgttcttttcatccacacgggggga
atattcggtctgttcgcgcagagcgggaggttggtataa

DBGET integrated database retrieval system