KEGG   Thermotoga naphthophila: Tnap_0912Help
Entry
Tnap_0912         CDS       T01139                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00010  Glycolysis / Gluconeogenesis
tnp00052  Galactose metabolism
tnp01100  Metabolic pathways
tnp01110  Biosynthesis of secondary metabolites
tnp01120  Microbial metabolism in diverse environments
tnp01130  Biosynthesis of antibiotics
Module
tnp_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tnap_0912
   00052 Galactose metabolism
    Tnap_0912
Enzymes [BR:tnp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Tnap_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADA67002
JGI: Tnap_0912
UniProt: D2C7R6
Position
949336..950424
Genome map
AA seq 362 aa AA seqDB search
MEYLMSHIEKEFFGATSEGIPVYQYTLINKNGMMAKIITYGAIVRELWVPDSSGTLSDVV
LGFDTLQEYEAKNSNFFFGAIVGRYANRIAGGRFEIDGVTYQLALNDGDRPNALHGGVKG
FYTRVFKAVPMKTPTGPSLVLKYLSHDGEEGYPGNLDLTVIYTLTNENELKVEYRATTDK
PTVVNLTQHSYFNLAGDGSILDHELMINADNYTPVDDNLIPTGEIAPVEGTPFDLRSFKV
LRDAIEPLKSTTTKGFDINYVLNGEDGKLKLAAVLRDKRSRRRMEVYTTEPGLQLYTGNF
LDVKGKCGTYYGPYSGLCLEAQHFPDSPNHANFPSTILRPGEEYRQVTVYRFVVNGCKEK
KN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggaatatctgatgagccacattgaaaaggagttcttcggagcaacttctgagggaata
cctgtatatcagtacacactcataaacaaaaatggaatgatggcaaagatcatcacttat
ggtgcgatagtgagagaattgtgggtgccagacagttctggcaccctttctgatgttgtt
ttgggatttgacacactccaggagtacgaagcaaagaactcgaacttcttcttcggggcg
atagtgggaagatacgcgaacagaatagccggtggaagattcgagatcgacggagtcacc
tatcagcttgccctgaacgatggagatcgtccaaacgcgctccacggtggtgtgaaggga
ttctacaccagggtcttcaaagccgttcccatgaaaacacccactggaccttcccttgtt
ctgaagtatttgagccacgatggcgaagaaggctatcctggcaatctggatctcacagtt
atctacactctcacaaacgaaaacgagctgaaggtagagtatcgtgccacaacggataaa
cccaccgttgtgaacctcacacaacattcctattttaaccttgccggtgatggttcaata
cttgatcacgagcttatgataaacgcagataactacacccccgttgatgataacctcata
ccaacaggagagattgcaccggttgaaggcacaccgttcgatttgagatctttcaaagtt
ctgagagacgccatcgaaccgttgaaaagcactacaacaaaaggtttcgatataaactac
gttttaaacggtgaagatggaaagctgaagcttgcagctgttctaagagacaagagatct
cgtcgaaggatggaggtctacacaacagagccgggtcttcaactctacacgggaaacttc
ctcgatgtgaagggaaaatgcggtacatactacggaccgtactcaggtttgtgtcttgaa
gcacagcacttccccgattctccaaatcatgcaaactttccaagcaccatcttgagacca
ggtgaggagtacaggcaggttactgtttatagatttgttgtaaacggttgtaaggaaaag
aaaaactaa

DBGET integrated database retrieval system