KEGG   Thermotoga naphthophila: Tnap_0921Help
Entry
Tnap_0921         CDS       T01139                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00010  Glycolysis / Gluconeogenesis
tnp00030  Pentose phosphate pathway
tnp00051  Fructose and mannose metabolism
tnp00052  Galactose metabolism
tnp00680  Methane metabolism
tnp01100  Metabolic pathways
tnp01110  Biosynthesis of secondary metabolites
tnp01120  Microbial metabolism in diverse environments
tnp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tnap_0921
   00030 Pentose phosphate pathway
    Tnap_0921
   00051 Fructose and mannose metabolism
    Tnap_0921
   00052 Galactose metabolism
    Tnap_0921
  Energy metabolism
   00680 Methane metabolism
    Tnap_0921
Enzymes [BR:tnp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tnap_0921
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Tnap_0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NRDD SpoOE-like Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ADA67011
JGI: Tnap_0921
UniProt: D2C7S5
Position
complement(961645..962904)
Genome map
AA seq 419 aa AA seqDB search
MAERLGILVGGGPAPGINSVISSVTIEAINNGLEVIGIYDGFKHLVEGKTNMVKKLSIED
VSRIHIEGGSILRTSRVNPAKSEETLEKTVQTLKKLGIKYLVTIGGGDTAFSASKVCERS
QGEIKVVHVPKTIDNDLPLPENMPTFGFETARHVATELVYNLMQDSRTTNRWYFVAMMGR
EAGHLALGVGKAASATITIIPEEFKEGVTLEEVCDVLDGAILKRKLMGRDDGVAIIGEGI
AEKMDPEELANIPGVIVEKDPHGHLRLAEIPLATILKRAIERRYAERGERIHIVDVTIGY
ELRSARPIPFDIVYTRTLGYSAVRFLLGDYSDLPGGMVCVVGGRIKILPFDAFMDPKTGR
TKVRVVDVRSEDYRVARKYMIRLEKKDLEDPETLEKLAKLAKMEPEEFKKKYWHTTELP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagattgggaatactcgttggcggagggccggcacctggaatcaacagtgtg
ataagttctgttaccatcgaagctataaacaacggactcgaagtgatcggaatatacgat
ggattcaaacacctcgtagagggaaaaacgaatatggtgaaaaaactttccatcgaagat
gtctctagaatccacatcgaaggtggatccattctcagaacctcgagggtgaatcctgcc
aaatccgaagaaaccctcgagaagacagttcagactctcaaaaagctcgggataaagtat
cttgttactatcggagggggcgacaccgcgttttctgcgagcaaagtgtgtgaaagatcg
cagggcgaaataaaggtggtccacgttccaaagactatagacaacgacctccctcttccg
gagaacatgcccacgttcggttttgaaacagcccgccacgtggccacagagctcgtttac
aatctcatgcaggactcaagaacaacgaacagatggtactttgtggccatgatgggaagg
gaagccgggcacctcgcactcggcgttggaaaagcagcgagtgcaacgatcacgatcatt
cctgaagagttcaaagagggagtgacactcgaagaagtgtgcgacgttctcgatggggcg
attctcaagagaaaactcatgggaagagacgatggagtagcaataataggtgaaggtatc
gcagaaaagatggatcctgaggaacttgccaacattcccggtgtgatagtcgaaaaagac
ccgcacggacacctgagacttgcagagatcccgctcgccaccattctgaaacgggcgatc
gagaggagatacgctgaaagaggtgaaagaatccatatcgtcgatgtcacaataggatac
gaactcagaagcgcacgtcccatacccttcgacatagtatacaccagaacactcggttac
agtgctgtgagatttctccttggagattattccgatctccctggcgggatggtgtgcgtg
gttggtggcagaatcaagattcttcccttcgacgctttcatggatccaaagaccggaagg
acaaaggtgagagtggtggatgttcgatcggaagattacagagtagcaagaaaatacatg
ataaggctggaaaagaaagatctcgaagatcccgaaactctcgaaaaactagcaaagctc
gcaaagatggaacctgaagaattcaaaaagaaatactggcacacgacagagcttccataa

DBGET integrated database retrieval system