KEGG   Thermotoga naphthophila: Tnap_0926Help
Entry
Tnap_0926         CDS       T01139                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tnp  Thermotoga naphthophila
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tnp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tnp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
967251..968306
Genome map
AA seq 351 aa AA seqDB search
MKVVVKVGSNLLVGSSGLKKSYIAELCREVARLKSQGHEISIITSGARAAGFTYLGKGKR
TQDLHIKQALCAVGQVQLMKVYENAFDFYGIKIAQILLTRDTFSNRKRYLNLRNTLIGLS
EFDVVPIVNENDTVATEEITLGDNDTLAAMFSIAWDADFLVLFTTVDGVIDENGNLIERF
DESVKLKDMGKSSWGTGGIRSKIEAALIASKCGVKTTICNGNDVSNLTRFVKGEPVGTVF
EPQGRLKAKKAWIAFLSEPAGKIYVNKGAEEALKIGNSLLPVGVTGVEGTFDVGDVVEIV
NEDGELVGRGIVNYSSSDLEKIAGHKSSDLKKILGYEGSKVVVHIDNMWVA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgttgtaaaggttggaagcaacctgcttgtgggaagttccggtttgaaaaag
tcctacatcgcggaactctgtcgtgaggttgcacgtttgaaaagtcaaggacacgaaatt
tctatcatcacatctggagcccgcgctgcgggttttacctatcttggaaagggaaaaagg
acacaggaccttcacataaaacaggccctctgcgctgtgggtcaggtccagctcatgaag
gtgtacgaaaacgccttcgatttctatggcatcaaaatcgcccagatcctgctcacgaga
gacactttttctaacagaaagagatacctgaacctcagaaacacactgatcggactctcg
gagttcgacgttgttcccattgtgaacgaaaacgacaccgttgcaacagaagaaatcaca
ctcggtgacaacgacacactcgctgccatgttctcaatagcctgggatgcggactttctt
gtgctttttacaacggtggatggtgttatagatgagaacggaaaccttatcgaaaggttc
gacgagtcagtgaaactgaaagatatgggaaagagcagctggggaactggtggcatcaga
tccaagatagaagccgcgttgatagcgtcaaagtgcggtgtgaaaacgaccatatgcaac
ggaaacgatgtttcaaatctcacaaggtttgtgaagggagaacccgtcggtactgttttt
gaaccacaaggacgtttgaaagcaaaaaaagcctggatcgcctttctctcagaacctgcg
gggaagatatacgtaaacaaaggagctgaagaagcactcaaaatcggtaatagcctgctg
cctgttggtgttacaggtgtagaaggaacgttcgatgtgggagatgtagtggagatagtg
aacgaagatggagagctcgttggtcggggaatcgtgaattattcgtcttcggatcttgag
aaaatagcgggtcacaaatcttccgatttgaaaaagatcctcgggtacgaaggaagtaag
gtggtcgttcacatagacaacatgtgggtagcttaa

DBGET integrated database retrieval system