KEGG   Thermotoga naphthophila: Tnap_0949Help
Entry
Tnap_0949         CDS       T01139                                 

Definition
Beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tnp  Thermotoga naphthophila
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tnap_0949
Enzymes [BR:tnp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Tnap_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
992948..994966
Genome map
AA seq 672 aa AA seqDB search
MVNPKLPVIWYGGDYYPEQWDEETFERDIRMFKEAGINVVTLGVFSWSLIQPDENTYDFS
FFEKVMDRLYKEGIYVCLATPTSAPPHWMTQKYPEILLTDVNGVKREKGGRQNFCPNSEK
YRYFARNIAEKLAEHFKDHPALVLWHVNNEYLNYCYCDTCARKFREWLKKRYGSLEELNR
RWYTRFWSQTFTSWEEIPVPTTKSVLFWRKDRYQSVLPELYLDYRRFMSESMLECFLEEY
RAIKKHTPDIPVTTNLIAATFKEWNYFEWANHMDVAAWDNYPGYKEDFSVISLRHSLIRG
LKEGKPFVLMEQSPSQACWRWYNPQKRPGEMRLWSYHALAHGAETLMFFQLRQSKGGVEK
FHGAVITHVDSPNTRVFQEVKRVGEEIKSLSDILDTRVVSQTALLFDWESWWAMEDTLTP
SLDFRYLNEVQKYFKALVKTGLGVDVVGKDQNFEGYRIIVAPALYMVDEELARKLKDYVS
NGGILILTTMSGIVDEDDQVVLGGYPGYLRDLMGGYVEEIDALPPEEKNEILMFGKRYEC
SLVFDYIKTTTAEVLGRFGRDYYMNEPAVLRNNYGKGWVYYVGSSTSFDLVWDLVKFIER
EHNLRAEIAPPDGVEVIKKVKGEKIFYFLFNHSHELQIVDLPEGMFRDLIKGNLYEKKAR
LQPLDVLILLKE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaatccgaaacttcctgtgatctggtacggaggagactactacccggaacagtgg
gacgaggaaacgttcgaaagagatatcaggatgttcaaagaagcaggtatcaacgtggtc
accctcggggttttctcatggagtcttatccaaccagacgagaacacttacgatttttcg
ttcttcgaaaaagtgatggatcgtctgtacaaagaaggtatctatgtctgtcttgctact
cccacatccgctccccctcactggatgacgcagaaataccctgaaatccttctcacagac
gtgaacggtgtaaagcgagagaagggaggcagacagaacttttgtcccaacagtgagaag
tacagatattttgcaagaaacatcgcagagaaactcgcagaacatttcaaggatcaccct
gctctcgttctttggcacgtgaacaacgaatatttgaactactgctactgtgatacgtgt
gccaggaagttccgcgagtggttgaagaagagatacggaagcctggaggagttgaacaga
aggtggtacacgagattctggtcccagacgttcacaagctgggaagagattccagttcca
acgacaaagagcgtgctcttctggaggaaggacaggtaccaatcagtcctgccggaactc
tacctggattacagacgtttcatgtctgagagcatgctcgagtgttttctggaggaatac
agggcaataaagaaacacactcccgacatacctgtaactacgaatctgattgcggcaact
ttcaaggagtggaactatttcgaatgggcgaatcatatggacgttgcagcatgggacaac
tatcccggttacaaagaagatttctccgtgatttctttgagacactctctgatacgcggt
ttgaaagaaggaaaacccttcgtcctaatggaacagtctccttcgcaggcgtgctggaga
tggtacaatccccagaaaagaccaggagagatgaggctctggagttatcacgctctcgct
cacggtgcagagactctcatgttctttcagctgagacaatcaaagggaggagtggaaaaa
ttccacggggctgttatcacacatgtcgacagtccgaacacaagggtctttcaggaagtg
aaaagagtgggagaagagataaagtccttatcggatattctcgacacaagggttgtctca
cagactgctcttcttttcgactgggaaagctggtgggcgatggaagacactctgacacct
agcctagacttcaggtatttaaacgaagtgcagaagtacttcaaggcacttgtgaaaacc
ggccttggagtcgatgttgttggtaaagatcagaattttgagggatacaggatcatcgtt
gctccggcgctttacatggtggacgaagaacttgcacggaagctgaaagattacgtctcg
aacggaggaatcttgatcctcacaacaatgagcggtattgtcgatgaagacgatcaggtt
gttctgggaggttatccaggttatcttcgcgatcttatggggggctatgtggaagaaata
gatgctttgccacctgaagagaagaacgaaatcttgatgtttggcaaaaggtacgagtgt
agtttggtgtttgactacataaaaaccaccacagcggaagtgctcggaagatttggaagg
gactattacatgaacgaacctgccgtgttgagaaacaactacggcaaaggatgggtttac
tacgtaggctcttccacgtctttcgatcttgtatgggatcttgtgaagttcatagagaga
gaacacaatctcagagcagagatcgcaccgccagatggtgtagaggtgataaagaaagtc
aaaggggaaaaaattttctacttcctcttcaatcattcccatgaactacagatcgttgat
ttgccggaaggaatgttcagggatctgatcaaaggaaatttgtatgaaaaaaaggcaaga
ctgcaaccgctcgatgttctgatccttctaaaagaatga

DBGET integrated database retrieval system