KEGG   Thermotoga naphthophila: Tnap_0949Help
Entry
Tnap_0949         CDS       T01139                                 

Definition
Beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tnp  Thermotoga naphthophila
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tnp00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
992948..994966
Genome map
AA seq 672 aa AA seqDB search
MVNPKLPVIWYGGDYYPEQWDEETFERDIRMFKEAGINVVTLGVFSWSLIQPDENTYDFS
FFEKVMDRLYKEGIYVCLATPTSAPPHWMTQKYPEILLTDVNGVKREKGGRQNFCPNSEK
YRYFARNIAEKLAEHFKDHPALVLWHVNNEYLNYCYCDTCARKFREWLKKRYGSLEELNR
RWYTRFWSQTFTSWEEIPVPTTKSVLFWRKDRYQSVLPELYLDYRRFMSESMLECFLEEY
RAIKKHTPDIPVTTNLIAATFKEWNYFEWANHMDVAAWDNYPGYKEDFSVISLRHSLIRG
LKEGKPFVLMEQSPSQACWRWYNPQKRPGEMRLWSYHALAHGAETLMFFQLRQSKGGVEK
FHGAVITHVDSPNTRVFQEVKRVGEEIKSLSDILDTRVVSQTALLFDWESWWAMEDTLTP
SLDFRYLNEVQKYFKALVKTGLGVDVVGKDQNFEGYRIIVAPALYMVDEELARKLKDYVS
NGGILILTTMSGIVDEDDQVVLGGYPGYLRDLMGGYVEEIDALPPEEKNEILMFGKRYEC
SLVFDYIKTTTAEVLGRFGRDYYMNEPAVLRNNYGKGWVYYVGSSTSFDLVWDLVKFIER
EHNLRAEIAPPDGVEVIKKVKGEKIFYFLFNHSHELQIVDLPEGMFRDLIKGNLYEKKAR
LQPLDVLILLKE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaatccgaaacttcctgtgatctggtacggaggagactactacccggaacagtgg
gacgaggaaacgttcgaaagagatatcaggatgttcaaagaagcaggtatcaacgtggtc
accctcggggttttctcatggagtcttatccaaccagacgagaacacttacgatttttcg
ttcttcgaaaaagtgatggatcgtctgtacaaagaaggtatctatgtctgtcttgctact
cccacatccgctccccctcactggatgacgcagaaataccctgaaatccttctcacagac
gtgaacggtgtaaagcgagagaagggaggcagacagaacttttgtcccaacagtgagaag
tacagatattttgcaagaaacatcgcagagaaactcgcagaacatttcaaggatcaccct
gctctcgttctttggcacgtgaacaacgaatatttgaactactgctactgtgatacgtgt
gccaggaagttccgcgagtggttgaagaagagatacggaagcctggaggagttgaacaga
aggtggtacacgagattctggtcccagacgttcacaagctgggaagagattccagttcca
acgacaaagagcgtgctcttctggaggaaggacaggtaccaatcagtcctgccggaactc
tacctggattacagacgtttcatgtctgagagcatgctcgagtgttttctggaggaatac
agggcaataaagaaacacactcccgacatacctgtaactacgaatctgattgcggcaact
ttcaaggagtggaactatttcgaatgggcgaatcatatggacgttgcagcatgggacaac
tatcccggttacaaagaagatttctccgtgatttctttgagacactctctgatacgcggt
ttgaaagaaggaaaacccttcgtcctaatggaacagtctccttcgcaggcgtgctggaga
tggtacaatccccagaaaagaccaggagagatgaggctctggagttatcacgctctcgct
cacggtgcagagactctcatgttctttcagctgagacaatcaaagggaggagtggaaaaa
ttccacggggctgttatcacacatgtcgacagtccgaacacaagggtctttcaggaagtg
aaaagagtgggagaagagataaagtccttatcggatattctcgacacaagggttgtctca
cagactgctcttcttttcgactgggaaagctggtgggcgatggaagacactctgacacct
agcctagacttcaggtatttaaacgaagtgcagaagtacttcaaggcacttgtgaaaacc
ggccttggagtcgatgttgttggtaaagatcagaattttgagggatacaggatcatcgtt
gctccggcgctttacatggtggacgaagaacttgcacggaagctgaaagattacgtctcg
aacggaggaatcttgatcctcacaacaatgagcggtattgtcgatgaagacgatcaggtt
gttctgggaggttatccaggttatcttcgcgatcttatggggggctatgtggaagaaata
gatgctttgccacctgaagagaagaacgaaatcttgatgtttggcaaaaggtacgagtgt
agtttggtgtttgactacataaaaaccaccacagcggaagtgctcggaagatttggaagg
gactattacatgaacgaacctgccgtgttgagaaacaactacggcaaaggatgggtttac
tacgtaggctcttccacgtctttcgatcttgtatgggatcttgtgaagttcatagagaga
gaacacaatctcagagcagagatcgcaccgccagatggtgtagaggtgataaagaaagtc
aaaggggaaaaaattttctacttcctcttcaatcattcccatgaactacagatcgttgat
ttgccggaaggaatgttcagggatctgatcaaaggaaatttgtatgaaaaaaaggcaaga
ctgcaaccgctcgatgttctgatccttctaaaagaatga

DBGET integrated database retrieval system