KEGG   Thermotoga naphthophila: Tnap_1001Help
Entry
Tnap_1001         CDS       T01139                                 

Definition
GTP cyclohydrolase II
Orthology
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
tnp  Thermotoga naphthophila
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:tnp00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1040978..1042144
Genome map
AA seq 388 aa AA seqDB search
MEELREAFEEGKPVILIDRNRENEADFVFPAQLITEDVVSFFVTYGKGLFCVTADEEDLL
KRGFVKLSSNYGANYFVPVDWGTGTGISALERAETCRKLAEGRYFHEFRYPGHVTVIGGI
GFQRRKGHTEASLEISELAGFSRHAVIVEILDEKGNSHNLDYVLKLSEKFSLPVLEMDDV
WREFVKRKLLMKKKAEATLPTDFGVFKVVSFENHLDGKEHFAIVKEPLEDPVAVRIHSEC
VTGDVLSSLRCDCGSQLANFLRYMSAHGGILIYLRQEGRGIGLSNKIAAYSLQDKGLDTV
EANRVLGFSEDERDYAPAAQILKALGIERVLLFTNNQRKTVGLEKYGIEVVETKRLYGRV
TPHNRFYLSTKMKKLGHELEEIFREVNS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggaagaactgagagaggcttttgaggaaggaaagcccgtcattttgatcgacagaaat
agagagaacgaagcagatttcgtttttcccgctcaactgatcaccgaagacgttgtgagc
tttttcgtcacatacgggaagggactcttctgtgttacagccgacgaggaagatcttttg
aagagagggttcgtaaaactttcctcgaactacggagcgaactacttcgtgccggtggac
tggggcactggcacggggatttcagcgttggagagggcagaaacgtgcagaaagcttgca
gaaggcaggtattttcatgagttcagatacccgggtcacgtcacggtgataggaggaatc
ggtttccagagacgaaaaggacacacggaggcatctctggaaatttctgagctcgcgggc
ttcagccgtcacgccgtgatcgtggaaattctggatgagaagggaaattctcacaatttg
gattatgttttgaagctctcagaaaaattttccctccccgttctggagatggacgatgtc
tggcgtgaatttgtgaagagaaagcttctcatgaagaaaaaagcagaagcaacacttcca
acggatttcggtgtcttcaaggttgtttctttcgaaaaccacctcgatggcaaagaacac
ttcgcaatcgttaaggaacccctcgaagatcccgttgctgtgagaatacactccgaatgc
gtgaccggggatgttctctcttctttgaggtgtgactgcggttcacagctggcgaatttt
ctcagatacatgtcagctcacggaggtatcctgatctatttgagacaggaagggagagga
atcggcctttcgaacaaaattgcagcctattctcttcaggacaaaggtttggacacggtg
gaggcaaacagagttcttggtttttctgaagacgaaagagattacgcaccggcagcgcag
atcttgaaagcccttggcatcgaaagggttcttctcttcaccaacaaccaaagaaagacg
gttggtcttgaaaaatacgggatcgaagttgtcgaaacgaagagactgtacggaagagta
acacctcacaacaggttctatctttcgacaaaaatgaaaaagctcggacacgaactcgaa
gaaatcttcagggaggtgaattcatga

DBGET integrated database retrieval system