KEGG   Thermotoga naphthophila: Tnap_1040Help
Entry
Tnap_1040         CDS       T01139                                 

Definition
(GenBank) phosphonopyruvate decarboxylase-related protein
  KO
K15635  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
tnp  Thermotoga naphthophila
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tnap_1040
  Energy metabolism
   00680 Methane metabolism
    Tnap_1040
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tnap_1040
Enzymes [BR:tnp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Tnap_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1078269..1079474)
Genome map
AA seq 401 aa AA seqDB search
MFDKQEFVSKLVTEEKAKIVLLVMDGLGDIPVNGKTPLQAANTPNLDNLAKESDLGQTIP
VLPGITPGSGPGHLSLFGYDPIRYQIGRGILEALGIGVEVGEKDVVARANFATWDGKVVL
DRRAGRPATEESSKVVQLLSEKIKKIEDVEITFYPGKEHRFVVKFTGEGLGDNVTDADPQ
KEGHPMVWAEGLDEPSKKTARITNELIKKIAEVLKDNPKINFALIRGFSKYPDLPKFPQV
YKMKAGAIATYPMYRGLAKLVGMEIIETGQTVADEIKTLKERWNDYDFFYVHVKKTDSYG
EDGKFEEKVKVIEEVDALIPEIVSLNPDVLVITGDHSTPVPLKAHSWHPVPLLIWSKYTR
RGLSQAFNEFECARGTLGTIHASDVMTLALAYAGKLEKFGA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataaacaggagttcgtgtcgaaactcgtcacagaagagaaggcaaagatcgtt
ctacttgtgatggatggccttggagacatccccgtgaatggaaaaacaccccttcaggct
gcaaacactccgaatctggacaacctagcaaaagaaagtgatcttgggcagacgataccc
gttcttcccggaatcaccccgggcagtggaccaggacatctttcactgttcggatacgat
cccataaggtaccagattggaagaggaatactcgaagctctcggcataggtgttgaggta
ggggaaaaagacgtcgttgcaagggcgaattttgccacctgggatggaaaagtggtcctc
gacagaagagccggaaggcctgccacagaagaatcctccaaggtggttcagctgctctcg
gaaaagataaagaaaatcgaagacgtggagatcactttctaccctggaaaggaacacaga
ttcgttgtgaaattcacaggagaagggctcggagataacgtgacagatgcagatccccag
aaagaaggacatcccatggtctgggcagaaggtctggacgaaccttcgaaaaaaacggca
aggatcaccaacgagttgatcaaaaagatagcggaagtcctgaaagacaatccgaagata
aacttcgccctcatcagaggtttttccaagtacccggatcttccgaaattccctcaagtt
tacaagatgaaagcgggagccatagcaacgtacccgatgtacagaggtcttgcaaagctc
gtgggaatggagataatagaaacgggccagactgtagccgacgagataaaaacgctgaag
gaaagatggaacgactacgacttcttctacgtccacgtgaagaaaaccgactcttacggt
gaggatggaaaattcgaagaaaaggtgaaggtgatagaagaggtcgatgcgctcattcca
gagatagtttctctgaatcccgacgttcttgtgatcacgggtgatcattccactcccgtt
ccgctgaaagcacacagctggcatcccgtacctcttctcatctggtcgaagtatacaaga
agaggtctttctcaagctttcaacgagttcgaatgcgcgaggggcacactcggaacgatc
cacgcaagcgacgtcatgacactggctctcgcgtacgccggaaagctggaaaaattcgga
gcatga

DBGET integrated database retrieval system