KEGG   Thermotoga naphthophila: Tnap_1139Help
Entry
Tnap_1139         CDS       T01139                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tnp  Thermotoga naphthophila
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tnp00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tnp00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1169299..1170633)
Genome map
AA seq 444 aa AA seqDB search
MAEFFPEIPKIQFEGKESTNPLAFKFYDPNEVIDGKPLKDHLKFSVAFWHTFVNEGRDPF
GDPTAERPWNRFSDPMDKAFARVDALFEFCEKLNIEYFCFHDRDIAPEGKTLRETNKILD
KVVERIKERMKDSNVKLLWGTANLFSHPRYMHGAATTCSADVFAYAAAQVKKALEITKEL
GGEGYVFWGGREGYETLLNTDLGLELENLARFLRMAVEYAKKIGFTGQFLIEPKPKEPTK
HQYDFDVATAYAFLKNHGLDEYFKFNIEANHATLAGHTFQHELRMARILGKLGSIDANQG
DLLLGWDTDQFPTNIYDTTLAMYEVIKAGGFTKGGLNFDAKVRRASYKVEDLFIGHIAGM
DTFALGFKIAYKLVKDGVFDKFIEEKYRSFKEGIGKEIVEGKTDFEKLEEYIIDKEDIEL
PSGKQEYLESLLNSYIVKTIAELR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatttttcccagaaatcccaaagattcagtttgaaggtaaggaaagcacgaat
ccgctggcgttcaagttctacgatccgaacgaggtgatcgatggaaagcctctcaaggat
cacctgaagttttccgtcgccttctggcacaccttcgtgaacgagggaagagatccgttt
ggagatccaaccgctgaacgcccatggaacaggttctccgatcccatggacaaagctttt
gcgagggtggacgctctcttcgagttctgcgaaaagctcaacatcgagtacttctgtttc
cacgacagagacatcgctcccgaaggaaaaacgctcagagagacaaacaagatactggac
aaagtggtggaaagaataaaggaaagaatgaaggacagcaacgtgaaactcctctgggga
acggcgaatctgttctcccatccgaggtacatgcacggcgccgcgacgacctgcagtgcg
gatgtctttgcctacgcggcagcccaggtgaagaaagccctcgagatcacaaaagaacta
ggaggagaaggctacgtcttctggggtggaagagaaggctatgagacactcctaaacaca
gatctcgggctggaactcgaaaatctcgcgagatttctcagaatggcagtagagtacgca
aagaagatcggcttcaccggacagttcctcatagaacccaagccgaaagaacccaccaag
caccagtacgatttcgatgtggcaacggcctacgctttcctgaagaaccacggccttgat
gagtacttcaagttcaacatcgaagcgaaccacgcgacgcttgccggccacaccttccag
cacgaactgaggatggcaaggatcctcggaaaactcggaagcatcgacgccaaccaggga
gatctcctgctcggctgggacaccgaccagttcccaacgaacatctacgacacaacactt
gccatgtacgaagtgataaaagcaggaggattcacaaaaggtggcctcaacttcgacgcg
aaggtgaggagggcttcctacaaggtagaagatctcttcatcggtcacatcgcaggaatg
gacaccttcgctctcggcttcaaaatagcgtacaaactcgtaaaagacggagtattcgac
aagttcatcgaggaaaaatacagaagcttcaaagaaggtattggaaaagagatcgtagaa
ggaaaaaccgatttcgaaaaactcgaagagtatataatagacaaagaagatatcgaactt
ccatctggaaagcaggagtacctcgaaagcctgctcaacagctacatagtgaagacaata
gcagaactgaggtga

DBGET integrated database retrieval system