KEGG   Thermotoga naphthophila: Tnap_1139Help
Entry
Tnap_1139         CDS       T01139                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tnp  Thermotoga naphthophila
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tnap_1139
   00051 Fructose and mannose metabolism
    Tnap_1139
Enzymes [BR:tnp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Tnap_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1169299..1170633)
Genome map
AA seq 444 aa AA seqDB search
MAEFFPEIPKIQFEGKESTNPLAFKFYDPNEVIDGKPLKDHLKFSVAFWHTFVNEGRDPF
GDPTAERPWNRFSDPMDKAFARVDALFEFCEKLNIEYFCFHDRDIAPEGKTLRETNKILD
KVVERIKERMKDSNVKLLWGTANLFSHPRYMHGAATTCSADVFAYAAAQVKKALEITKEL
GGEGYVFWGGREGYETLLNTDLGLELENLARFLRMAVEYAKKIGFTGQFLIEPKPKEPTK
HQYDFDVATAYAFLKNHGLDEYFKFNIEANHATLAGHTFQHELRMARILGKLGSIDANQG
DLLLGWDTDQFPTNIYDTTLAMYEVIKAGGFTKGGLNFDAKVRRASYKVEDLFIGHIAGM
DTFALGFKIAYKLVKDGVFDKFIEEKYRSFKEGIGKEIVEGKTDFEKLEEYIIDKEDIEL
PSGKQEYLESLLNSYIVKTIAELR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatttttcccagaaatcccaaagattcagtttgaaggtaaggaaagcacgaat
ccgctggcgttcaagttctacgatccgaacgaggtgatcgatggaaagcctctcaaggat
cacctgaagttttccgtcgccttctggcacaccttcgtgaacgagggaagagatccgttt
ggagatccaaccgctgaacgcccatggaacaggttctccgatcccatggacaaagctttt
gcgagggtggacgctctcttcgagttctgcgaaaagctcaacatcgagtacttctgtttc
cacgacagagacatcgctcccgaaggaaaaacgctcagagagacaaacaagatactggac
aaagtggtggaaagaataaaggaaagaatgaaggacagcaacgtgaaactcctctgggga
acggcgaatctgttctcccatccgaggtacatgcacggcgccgcgacgacctgcagtgcg
gatgtctttgcctacgcggcagcccaggtgaagaaagccctcgagatcacaaaagaacta
ggaggagaaggctacgtcttctggggtggaagagaaggctatgagacactcctaaacaca
gatctcgggctggaactcgaaaatctcgcgagatttctcagaatggcagtagagtacgca
aagaagatcggcttcaccggacagttcctcatagaacccaagccgaaagaacccaccaag
caccagtacgatttcgatgtggcaacggcctacgctttcctgaagaaccacggccttgat
gagtacttcaagttcaacatcgaagcgaaccacgcgacgcttgccggccacaccttccag
cacgaactgaggatggcaaggatcctcggaaaactcggaagcatcgacgccaaccaggga
gatctcctgctcggctgggacaccgaccagttcccaacgaacatctacgacacaacactt
gccatgtacgaagtgataaaagcaggaggattcacaaaaggtggcctcaacttcgacgcg
aaggtgaggagggcttcctacaaggtagaagatctcttcatcggtcacatcgcaggaatg
gacaccttcgctctcggcttcaaaatagcgtacaaactcgtaaaagacggagtattcgac
aagttcatcgaggaaaaatacagaagcttcaaagaaggtattggaaaagagatcgtagaa
ggaaaaaccgatttcgaaaaactcgaagagtatataatagacaaagaagatatcgaactt
ccatctggaaagcaggagtacctcgaaagcctgctcaacagctacatagtgaagacaata
gcagaactgaggtga

DBGET integrated database retrieval system