KEGG   Thermotoga naphthophila: Tnap_1140Help
Entry
Tnap_1140         CDS       T01139                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00300  Lysine biosynthesis
tnp01100  Metabolic pathways
tnp01120  Microbial metabolism in diverse environments
tnp01230  Biosynthesis of amino acids
Module
tnp_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tnp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tnap_1140
Enzymes [BR:tnp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tnap_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 SpoOE-like
Motif
Other DBs
NCBI-ProteinID: ADA67226
JGI: Tnap_1140
UniProt: D2C8E0
Position
1170738..1171928
Genome map
AA seq 396 aa AA seqDB search
MEITKRIEELREEMVESLKKFISINSVNPAFGGPGEKEKADWLEGLLRDFGFEVERYDVK
DDRGIWRSNVVAKIPGRNREKTLWIVTHIDTVPPGDLSLWETDPFVPVVKDGKVYGRGAE
DNGGSMIASIYAGKVLIDLGITPEYNFGLALVADEEAGSGYGIQYLIEKGLFSPEDMFLV
PDAGNEKGDFIEIAEKSILWFKVTVNGKQGHASRPRTTENALRKGVYLIAEIDEALHRKY
SDIDELFDEPLSTFEPTRAEKTVDNVNTVPGRFVFYFDCRVLPRYDLNEVLSTIESILDG
RGAELEVVVKQPAPKPTPPDSELVVKLSDVLRSLRGLEAKVGGIGGGTCAAFFRKKGWPA
VVWSTIDGTAHQPNEYRRISHMVEDAKVFALLGTER
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggagatcacaaaaagaatagaagagctcagagaggaaatggtggaatccttgaagaaa
ttcatctccatcaattcggtgaatcccgcctttggaggcccaggagagaaagaaaaggcc
gactggctcgaaggtctcctcagggatttcggtttcgaggtcgaacgctacgatgtgaaa
gacgataggggcatatggcgatcgaacgttgtagcaaagattccaggaagaaacagagaa
aaaacgctttggatcgtgactcacatcgacactgtaccaccgggagatctctctttgtgg
gagacggatcctttcgtgcccgttgtgaaagacgggaaggtttacggtaggggagccgaa
gacaacggaggttccatgatagcctccatatacgctgggaaggtcctcatcgaccttggt
atcactcctgagtacaacttcggtcttgcgctcgtcgccgacgaggaggcaggaagcgga
tatggaatccaatatctgatagaaaaagggttgttcagcccagaagacatgttcctggtc
ccggatgccggaaacgaaaagggagacttcatcgagatcgcagagaagagtatcctgtgg
ttcaaagtgacggtgaacggaaaacagggacacgcttcaagaccgaggacaacggagaac
gctctcagaaaaggtgtgtatctcatagcggagatagatgaagcgcttcacaggaaatac
tccgatatagacgaactcttcgatgaaccgctcagcacgttcgaacccactcgagctgaa
aaaactgtggacaacgtgaacaccgttcccggcaggttcgttttttactttgactgcagg
gttctgccccgctacgatctcaacgaagtgctgtccaccatcgagtcgattctagacgga
agaggtgcagagctggaggtcgttgtgaaacagcccgcacccaagccaactccacccgat
tcggaactcgtggtgaaactttccgatgttttgagaagtctaagagggctggaagcgaaa
gtgggaggtataggtggaggcacctgcgccgcgttcttcagaaagaaaggctggcccgct
gtcgtctggagcacaatagacgggactgctcatcagcccaacgagtaccgaaggatatcg
cacatggtggaagatgcgaaggtgttcgcacttctcggaactgagaggtga

DBGET integrated database retrieval system